Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G56150-AT3G12830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAUR-like auxin-responsive protein family
Function (paralog2):SAUR-like auxin-responsive protein family

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.62942338991355
Log2 mRNA fold difference:0.45288610096616
Log2 TE fold difference:0.13795279805895
Sequences
Protein sequence

MKQLIRRLSRVADSTQYSLLRSESQRGRTKKEKHKSWVPEGHVPVYVGHEMERFVVNAEL
LNHPVFVALLKQSAQEYGYEQQGVLRIPCHVLVFERILESLRLGLADRVT

MKQLIRRLSRVADSAQYSLLRSDSQRPSRRSESFLRSSVTRRSKKQTSSVPEGHVPVYVG
DEMERFVVSAELLNHPVFIGLLNRSAQEYGYEQKGVLQIPCHVLVFERIMESLRLGLPVP
IDVQDLIGDGTI

Other information
Ka divergence:-0.199264KaKs divergence:-0.0434783
GC content 1 (%):55GC content 2 (%):50GC content divergence:-0.048
Length 1 (bp):333Length 2 (bp):399Length divergence:0.09
MFE 1 (kcal):-117.3MFE 2 (kcal):-112.4MFE divergence-0.021