Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G56190-AT3G12780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phosphoglycerate kinase family protein
Function (paralog2):phosphoglycerate kinase 1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.58755982001363
Log2 mRNA fold difference:-0.26974618427789
Log2 TE fold difference:0.8560235962533
Sequences
Protein sequence

MASTAATAALSIIKSTGGAAVTRSSRASFGHIPSTSVSARRLGFSAVVDSRFSVHVASKV
HSVRGKGARGVITMAKKSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPT
IKFLIENGAKVILSTHLGRPKGVTPKFSLAPLVPRLSELLGIEVVKADDCIGPEVETLVA
SLPEGGVLLLENVRFYKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLK
PSVAGFLLQKELDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGGMIF
TFYKAQGLSVGSSLVEEDKLELATTLLAKAKARGVSLLLPTDVVIADKFAPDANSKIVPA
SAIPDGWMGLDIGPDSVKTFNEALDTTQTVIWNGPMGVFEFEKFAKGTEAVANKLAELSK
KGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVVALDEATPVTV

MASAAASSAFSLLKSTGAVASSAGTRARASLLPIPSTSVSARPLGFSATLDSRRFSLHVA
SKVESVRGKGSRGVVSMAKKSVGDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAA
IPTIKYLIENGAKVILSTHLGRPKGVTPKFSLAPLVPRLSELLGIEVTKADDCIGPEVES
LVASLPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTK
FLKPSVAGFLLQKELDYLVGAVSNPKRPFAAIVGGSKVSSKIGVIESLLEKCDILLLGGG
MIFTFYKAQGLSVGSSLVEEDKLELATELLAKAKAKGVSLLLPTDVVVADKFAPDANSKI
VPASGIEDGWMGLDIGPDSIKTFNEALDTTQTVIWNGPMGVFEMEKFAAGTEAIANKLAE
LSEKGVTTIIGGGDSVAAVEKVGVAGVMSHISTGGGASLELLEGKVLPGVIALDEAIPVT
V

www.000webhost.com

Other information
Ka divergence:-0.129042KaKs divergence:-0.281215
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):1437Length 2 (bp):1446Length divergence:0.003
MFE 1 (kcal):-511.1MFE 2 (kcal):-499.5MFE divergence-0.011