Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G60680-AT1G60690
Species:Arabidopsis
Duplication type:TD
Function (paralog1):NAD(P)-linked oxidoreductase superfamily protein
Function (paralog2):NAD(P)-linked oxidoreductase superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-3.1734630733745
Log2 mRNA fold difference:-3.4832179167233
Log2 TE fold difference:0.33146402107128
Sequences
Protein sequence

MAEACRVRRMKLGSQGLEVSAQGLGCMALSARYGAPKPETDAIALLHHAINSGVTFFDTS
DMYGPETNELLLGKALKDGVKEKVELATKFGFFIVEGEISEVRGDPEYVRAACEASLKRL
DIACIDLYYQHRIDTRVPIEITMRELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAV
QIEWSLWSRDAEEDIIPICRELGIGIVAYSPLGRGFLAAGPKLAENLENDDFRKTLPRFQ
QENVDHNKILFEKVSAMAEKKGCTPAQLALAWVHHQGDDVCPIPGTTKIENLNQNIRALS
VKLTPEEISELDSLAKPESVKGERYMASMSTFKNSNTPPLSSWKAT

MAESCRVRRIKLGSQGLEVSAQGLGCMGLTGHYGASKPETEAIALIHHAIHSGVTFLDTS
DMYGPETNEILLGKALKDGVREKVELATKFGISYAEGNREIKGDPAYVRAACEASLKRLD
VTCIDLYYQHRIDTRVPIEITMGELKKLIEEGKIKYIGLSEASASTIRRAHTVHPITAVQ
LEWSLWTRDVEEEIVPTCRELGIGIVSYSPLGRGFFASGPKLVENLDNNDFRKALPRFQQ
ENLDHNKILYEKVSAMSEKKGCTPAQLALAWVHHQGDDVCPIPGTTKIENLNQNIRALSV
KLTPEEMSELETIAQPESVKGERYMATVPTFKNSDTPPLSSWNAV

www.000webhost.com

Other information
Ka divergence:-0.186729KaKs divergence:0.983379
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1041Length 2 (bp):1038Length divergence:-0.001
MFE 1 (kcal):-318.85MFE 2 (kcal):-305.83MFE divergence-0.021