Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G60830-AT1G60900
Species:Arabidopsis
Duplication type:TD
Function (paralog1):RNA-binding (RRM/RBD/RNP motifs) family protein
Function (paralog2):U2 snRNP auxilliary factor, large subunit, splicing factor

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.75247378830932
Log2 mRNA fold difference:0.32993505230635
Log2 TE fold difference:0.3679852636069
Sequences
Protein sequence

MLQPGGTPTKIVCLTQVVTADDLRDDAEYADIMEDMSQEGGKFGNLVNVVIPRPNPDHDP
TPGVGKVFLEYADVDGSSKARSGMNGRKFGGNQVVAVYYPEDKYAQGDYED

MMSYEGNGDGVAISTENHNENYISLESSPFHEDSKSRESHDLKKDSSKISEKDNENGRDK
DGNKDRDREKDRDREKSRDRDREKSRDRDRDRERSKDRQRDRHHRDRHRDRSRERSEKRD
DLDDDHHRRSRDRDRRRSRDRDREVRHRRRSRSRSRSRSERRSRSEHRHKSEHRSRSRSR
SRSKSKRRSGFDMAPPDMLAATAVAAAGQVPSVPTTATIPGMFSNMFPMVPGQQLGALPV
LPVQAMTQQATRHARRVYVGGLPPTANEQSVSTFFSQVMSAIGGNTAGPGDAVVNVYINH
EKKFAFVEMRSVEEASNAMALDGIILEGVPVKVRRPTDYNPSLAATLGPSQPNPNLNLGA
VGLSSGSTGGLEGPDRIFVGGLPYYFTEVQIRELLESFGPLRGFNLVKDRETGNSKGYAF
CVYQDPSVTDIACAALNGIKMGDKTLTVRRAIQGAIQPKPEQEEVLLYAQQQIALQRLMF
QPGGTPTKIVCLTQVVTADDLRDDEEYAEIMEDMRQEGGKFGNLVNVVIPRPNPDHDPTP
GVGKVFLEYADVDGSSKARSGMNGRKFGGNQVVAVYYPEDKYAQGDYED

Other information
Ka divergence:-0.0614887KaKs divergence:-0.999764
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):336Length 2 (bp):1770Length divergence:0.681
MFE 1 (kcal):-91.23MFE 2 (kcal):-569.91MFE divergence0.724