Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G61180-AT1G61190
Species:Arabidopsis
Duplication type:TD
Function (paralog1):LRR and NB-ARC domains-containing disease resistance protein
Function (paralog2):LRR and NB-ARC domains-containing disease resistance protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.1014701261234
Log2 mRNA fold difference:1.1475995017688
Log2 TE fold difference:-0.083114712830979
Sequences
Protein sequence

MGSCFSLQVSDQTLNRIFNCLIGKSYIRTLEKNLRALQREMEDLRAIQHEVQNKVARDEA
RHQRRLEAVQVWLDRVNSVDIECKDLLSVTPVELQKLCLCGLCSKYVCSSYKYGKKVFLL
LEEVKKLNSEGNFDEVSQPPPRSEVEERPTQPTIGQEDMLEKAWNRLMEDGVGIMGLHGM
GGVGKTTLFKKIHNKFAEIGGTFDIVIWIVVSKGVMISKLQEDIAEKLHLCDDLWKNKNE
SDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRSREVCGEMGD
HKPMQVNCLEPEDAWELFKNKVGDNTLSSDPVIVELAREVAQKCRGLPLALNVIGETMSS
KTMVQEWEHAIHVFNTSAAEFSDMQNKILPILKYSYDSLGDEHIKSCFLYCALFPEDGEI
YNEKLIDYWICEGFIGEDQVIKRARNKGYAMLGTLTRANLLTKVGTYYCVMHDVVREMAL
WIASDFGKQKENFVVQAGVGLHEIPKVKDWGAVRKMSLMDNDIEEITCESKCSELTTLFL
QSNKLKNLPGAFIRYMQKLVVLDLSYNRDFNKLPEQISGLVSLQFLDLSNTSIEHMPIGL
KELKKLTFLDLTYTDRLCSISGISRLLSLRLLRLLGSKVHGDASVLKELQQLQNLQELAI
TVSAELISLDQRLAKLISNLCIEGFLQKPFDLSFLASMENLSSLRVENSYFSEIKCRESE
TESSYLRINPKIPCFTNLSRLEIMKCHSMKDLTWILFAPNLVVLLIEDSREVGEIINKEK
ATNLTSITPFLKLEWLILYNLPKLESIYWSPLPFPVLLTMDVSNCPKLRKLPLNATSVSK
VEEFEIHMYPPPEQENELEWEDDDTKNRFLPSIKPVIISFNLLCLSYLYFLLMFLSRLA

MGNFVCIEISGDQMLDRIIRCLCGKGYIRNLEKNLRALQREMEDLRATQHEVQNKVAREE
SRHQQRLEAVQVWLDRVNSIDIECKDLLSVSPVELQKLCLCGLCSKYVCSSYKYGKRVFL
LLEEVTKLKSEGNFDEVSQPPPRSEVEERPTQPTIGQEEMLKKAWNRLMEDGVGIMGLHG
MGGVGKTTLFKKIHNKFAETGGTFDIVIWIVVSQGAKLSKLQEDIAEKLHLCDDLWKNKN
ESDKATDIHRVLKGKRFVLMLDDIWEKVDLEAIGIPYPSEVNKCKVAFTTRDQKVCGQMG
DHKPMQVKCLEPEDAWELFKNKVGDNTLRSDPVIVGLAREVAQKCRGLPLALSCIGETMA
SKTMVQEWEHAIDVLTRSAAEFSDMQNKILPILKYSYDSLEDEHIKSCFLYCALFPEDDK
IDTKTLINKWICEGFIGEDQVIKRARNKGYEMLGTLIRANLLTNDRGFVKWHVVMHDVVR
EMALWIASDFGKQKENYVVRARVGLHEIPKVKDWGAVRRMSLMMNEIEEITCESKCSELT
TLFLQSNQLKNLSGEFIRYMQKLVVLDLSHNPDFNELPEQISGLVSLQYLDLSWTRIEQL
PVGLKELKKLIFLNLCFTERLCSISGISRLLSLRWLSLRESNVHGDASVLKELQQLENLQ
DLRITESAELISLDQRLAKLISVLRIEGFLQKPFDLSFLASMENLYGLLVENSYFSEINI
KCRESETESSYLHINPKIPCFTNLTGLIIMKCHSMKDLTWILFAPNLVNLDIRDSREVGE
IINKEKAINLTSIITPFQKLERLFLYGLPKLESIYWSPLPFPLLSNIVVKYCPKLRKLPL
NATSVPLVEEFEIRMDPPEQENELEWEDEDTKNRFLPSIKPLVRRLKIHYSGMGFLNVKN
QNPRFFFYCFIYLLVVHLDCIIDLHSDTSGMCCVVHLDYVFHFPFVFPKTFCILFRLHFY
TIKSLCV

Other information
Ka divergence:0.371145KaKs divergence:0.308273
GC content 1 (%):40GC content 2 (%):40GC content divergence:0
Length 1 (bp):2700Length 2 (bp):2904Length divergence:0.036
MFE 1 (kcal):-770.96MFE 2 (kcal):-798.63MFE divergence0.018