Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G61360-AT1G61370
Species:Arabidopsis
Duplication type:TD
Function (paralog1):S-locus lectin protein kinase family protein
Function (paralog2):S-locus lectin protein kinase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.6003886733953
Log2 mRNA fold difference:-1.9806868615817
Log2 TE fold difference:0.35195814242732
Sequences
Protein sequence

MRIVACLLLITALFSSYGYAAITTSSPLSIGVTLSSPGGSYELGFFSSNNSGNQYVGIWF
KKVTPRVIVWVANREKPVSSTMANLTISSNGSLILLDSKKDLVWSSGGDPTSNKCRAELL
DTGNLVVVDNVTGNYLWQSFEHLGDTMLPLTSLMYDIPNNKKRVLTSWKSETDPSPGEFV
AEITPQVPSQGLIRKGSSPYWRSGPWAGTRFTGIPEMDASYVNPLGMVQDEVNGTGVFAF
CVLRNFNLSYIKLTPEGSLRITRNNGTDWIKHFEGPLTSCDLYGRCGPFGLCVRSGTPMC
QCLKGFEPKSDEEWRSGNWSRGCVRRTNLSCQGNSSVETQGKDRDVFYHVSNIKPPDSYE
LASFSNEEQCHQGCLRNCSCTAFSYVSGIGCLVWNQELLDTVKFIGGGETLSLRLAHSEL
TGRKRIKIITVATLSLSVCLILVLVACGCWRYRVKQNGSSLVSKDNVEGAWKSDLQSQDV
SGLNFFEIHDLQTATNNFSVLNKLGQGGFGTVYKGKLQDGKEIAVKRLTSSSVQGTEEFM
NEIKLISKLQHRNLLRLLGCCIDGEEKLLVYEYMVNKSLDIFIFDLKKKLEIDWATRFNI
IQGIARGLLYLHRDSFLRVVHRDLKVSNILLDEKMNPKISDFGLARLFHGNQHQDSTGSV
VGTLGYMSPEYAWTGTFSEKSDIYSFGVLMLEIITGKEISSFSYGKDNKNLLSYAWDSWS
ENGGVNLLDQDLDDSDSVNSVEAGRCVHIGLLCVQHQAIDRPNIKQVMSMLTSTTDLPKP
TQPMFVLETSDEDSSLSHSQRSNDLSSVDENKSSEELNASS

MGKIGIVFFASLLFLLIIFPSCAFAAITRASPLSIGQTLSSPNGTYELGFFSPNNSRNQY
VGIWFKNITPRVVVWVANRDKPVTNNAANLTINSNGSLILVEREQNVVWSIGETFSSNEL
RAELLENGNLVLIDGVSERNLWESFEHLGDTMLLESSVMYDVPNNKKRVLSSWKNPTDPS
PGEFVAELTTQVPPQGFIMRGSRPYWRGGPWARVRFTGIPEMDGSHVSKFDISQDVAAGT
GSLTYSLERRNSNLSYTTLTSAGSLKIIWNNGSGWVTDLEAPVSSCDVYNTCGPFGLCIR
SNPPKCECLKGFVPKSDEEWNKRNWTGGCMRRTNLSCDVNSSATAQANNGDIFDIVANVK
PPDFYEYLSLINEEDCQQRCLGNCSCTAFSYIEQIGCLVWNRELVDVMQFVAGGETLSIR
LASSELAGSNRVKIIVASIVSISVFMILVFASYWYWRYKAKQNDSNPIPLETSQDAWREQ
LKPQDVNFFDMQTILTITNNFSMENKLGQGGFGPVYKGNLQDGKEIAIKRLSSTSGQGLE
EFMNEIILISKLQHRNLVRLLGCCIEGEEKLLIYEFMANKSLNTFIFDSTKKLELDWPKR
FEIIQGIACGLLYLHRDSCLRVVHRDMKVSNILLDEEMNPKISDFGLARMFQGTQHQANT
RRVVGTLGYMSPEYAWTGMFSEKSDIYAFGVLLLEIITGKRISSFTIGEEGKTLLEFAWD
SWCESGGSDLLDQDISSSGSESEVARCVQIGLLCIQQQAGDRPNIAQVMSMLTTTMDLPK
PKQPVFAMQVQESDSESKTMYSVNNITQTAIVGR

www.000webhost.com

Other information
Ka divergence:-0.111666KaKs divergence:-0.568092
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):2466Length 2 (bp):2445Length divergence:-0.004
MFE 1 (kcal):-754.24MFE 2 (kcal):-740.32MFE divergence-0.009