Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G61415-AT1G61450
Species:Arabidopsis
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.7053190234708
Log2 mRNA fold difference:3.0272316417775
Log2 TE fold difference:-0.36161748193823
Sequences
Protein sequence

MEDSGAILCQISIFKDMLDQVNREIEANIQVTREIESQIGNCSETESALSVKEAELTKSF
LASQFEINGLISVTADSRNSLKLLEDEICRLRNEHSELITRLTEKREGFVKMCFGFQREI
EDSEFRNLLLEREFLDNEVRMLEEKNLDVKNSILAYMEDEMMNLLSD

MEDSGAILCQISIFKDMLDQVNREIEANIQVTREIESQIGACSEIESSLSLKEPELTRSF
LASQFEISGLISVTADSRNSLKLLEDEICCLRSEHSELITKTNREAGRVCEDVFWIPKRD

www.000webhost.com

Other information
Ka divergence:0.567325KaKs divergence:0.652514
GC content 1 (%):40GC content 2 (%):43GC content divergence:0.036
Length 1 (bp):504Length 2 (bp):363Length divergence:-0.163
MFE 1 (kcal):-143.42MFE 2 (kcal):-115.7MFE divergence-0.107