Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G61810-AT1G61820
Species:Arabidopsis
Duplication type:TD
Function (paralog1):beta-glucosidase 45
Function (paralog2):beta glucosidase 46

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.4982053540336
Log2 mRNA fold difference:2.8573935668342
Log2 TE fold difference:-1.2583653469609
Sequences
Protein sequence

MKNLTSFVIVILLQSLLFHVYGRHQSSSKNILVDSSPFPSDFLFGTASSAYQYEGAFLTD
GKSLNNWDVFTHKNPGKILDKNNADRAVDQYNRFLEDIQLMSFLGVNSYRFSISWCRILP
RGRFGEINYLGIKYYNIFIDALISRGIKPFVTLNHVDYPQELEDRFQSWLNPEMQKEFGY
LADICFKHFGNRVKYWTTLNEPNQQLILGYLTGKFPPSRCSSPYGNCSQGNSETEPFIAA
HNMILAHAKAVNIYKTKYQKEQKGSIGIVVQTSWFEPISDSNADKEAAERAQSFYSNWIL
DPVIYGKYPKEMVDILGPALPQFSSNEVKNLEKSRADFVGINHYTSYFIQDCLTSACNTG
HGAFKAEGYALKLDRKGNVTIGELTDVNWQHIDPTGFHKMLNYLKDRYPNMPMFITENGF
GDLQKPETTDKELLNDTKRIQYMSGYLEALQAAMRDGANVKGYFVWSLLDNFEWLFGYKV
RFGLFHVDLTTLKRSKLRYETSDDSYEARSSHVTNHILSRRNTNPFTKWVNVLRRTSTSC
TKP

MKTFANFAILFLLQSLLFPLYSSCLHQTSDDSSPFPSDFLFGTASSAFQYEGAFLTDGKG
LNNWDVFAHENPGKIVDGSNGDIATDQYHRYMEDIQSMNFLGVNSYRLSISWSRVLPNGR
FGVINYKGIKYYNNLIDALIKKGITPFVTLNHFDYPQELENRFKSWLSSEMQKDFGYLAD
ICFKHFGDRVKHWITINEPNQHISLAYRSGLFPPARCSMPYGNCTHGNSETEPFIAAHNM
ILAHAKAIQIYRTKYQREQKGIIGIVVQTSWFEPISDSIADKNAAERAQSFYSNWILDPV
VYGKYPEEMVNLLGSALPKFSSNEMNSLMSYKSDFLGINHYTSYFIQDCLITACNSGDGA
SKSEGLALKLDRKGNVSIGELTDVNWQHIDPNGFRKMLNYLKNRYHNIPMYITENGFGQL
QKPETTVEELLHDTKRIQYLSGYLDALKAAMRDGANVKGYFAWSLLDNFEWLYGYKVRFG
LFHVDFTTLKRTPKQSATWYKNFIEQNVNIEDQIDK

www.000webhost.com

Other information
Ka divergence:-0.106832KaKs divergence:0.235712
GC content 1 (%):39GC content 2 (%):38GC content divergence:-0.013
Length 1 (bp):1632Length 2 (bp):1551Length divergence:-0.025
MFE 1 (kcal):-422.21MFE 2 (kcal):-401.5MFE divergence-0.025