Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G62262-AT1G62280
Species:Arabidopsis
Duplication type:TD
Function (paralog1):SLAC1 homologue 4
Function (paralog2):SLAC1 homologue 1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:4.1709402970705
Log2 mRNA fold difference:3.6718429719833
Log2 TE fold difference:0.43941751824874
Sequences
Protein sequence

MEIPSQEIHIMIDNTISRRKERKTNLADAEPIVLMSVLSSLHAGYFRISLSLCSQALLWK
IMVHLHSELPSMAYYLLWYLALATQVSLCFLYAFKCIFLFDMVKEEFSHYIGVNYLYAPS
ISCLLLLQSAPMIEPHSVLYQTLFWIFAVPVLTLDTKLYGQWFTTEKRFLSIMANPASQV
SVIANLVAARGAAEMGWKECALCLFSLGMVHYLVIFVTLYQRLPGGNNFPTTLRPVFFLF
FAAPATASLAWNSICGNFDTIAKMLFFLSLFIFISLVCRPNLLKKSIKRFNVAWWAYSFP
ITFLALNSVQYAQEVKDHVASVLMFIFSSMSVLIFISVMLLTAANSKRLLRRDHVLWSST
GPKDK

MEIPRQEIHIEIDNSIPSSKEFKTGLADAKPVVLMSALRSLHAGYFRISLSLCSQALLWK
IMIAPESPSMSHMHSKLPSMAFHLLWYLALVTQVSLCFLYALKCIFFFDKVKEEFLHYIG
VNYLYAPSISWLLMLQSAPMMEPNSVLYQTLFWIFAVPVLTLDIKLYGQWFTTEKRFLSM
LANPASQVSVIANLVAARGAAEMGWNECALCMFSLGMVHYLVIFVTLYQRLPGGNNFPAK
LRPIFFLFVAAPAMASLAWNSICGTFDAVAKMLFFLSLFIFMSLVCRPNLFKKSMKRFNV
AWWAYSFPLTFLALDSVQYAQEVKDPVGSGLMLIFSSISVLIFLGMMVLTAANSNRLLRH
DPVLGSATDPKDKQKTLSLNATNQN

www.000webhost.com

Other information
Ka divergence:-0.285562KaKs divergence:-0.717838
GC content 1 (%):41GC content 2 (%):44GC content divergence:0.035
Length 1 (bp):1098Length 2 (bp):1158Length divergence:0.027
MFE 1 (kcal):-291.01MFE 2 (kcal):-337.1MFE divergence0.073