Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G62540-AT1G62560
Species:Arabidopsis
Duplication type:TD
Function (paralog1):flavin-monooxygenase glucosinolate S-oxygenase 2
Function (paralog2):flavin-monooxygenase glucosinolate S-oxygenase 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.3168200598182
Log2 mRNA fold difference:1.5140981258562
Log2 TE fold difference:0.77256019923175
Sequences
Protein sequence

MAPAQNPISSQHVVVIGAGAAGLVAARELSREGHTVVVLEREKEVGGLWIYSPKAESDPL
SLDPTRSIVHSSVYESLRTNLPRECMGFTDFPFVPRFDDESRDSRRYPSHMEVLAYLQDF
AREFNLEEMVRFEIEVVRVEPVNGKWRVWSKTSGGVSHDEIFDAVVVCSGHYTEPNVAHI
PGIKSWPGKQIHSHNYRVPGPFENEVVVVIGNFASGADISRDIAKVAKEVHIASRASEFD
TYEKLPVPRNNLWIHSEIDTAYEDGSIVFKNGKVVYADSIVYCTGYKYRFTFLETNGYMN
IDENRVEHLYKHVFPPALSPGLSFVGLPSMGIQFVMFEIQSKWVAAVLSRRVTLPTEDKM
MEDISAWYASLDAVGIPKRYTHKLGKIQSEYLNWVAEECGCPLVEHWRNQQIVRGYQRLV
SHPETYRDEWDDNDLMEEAYEDFARKKLISFHPSHIL

MAPAQNQITSKHVAVIGAGPAGLITSRELRREGHSVVVFEREKQVGGLWVYTPKSDSDPL
SLDPTRSKVHSSIYESLRTNVPRESMGVRDFPFLPRFDDESRDARRYPNHREVLAYIQDF
AREFKIEEMIRFETEVVRVEPVDNGNWRVQSKNSGGFLEDEIYDAVVVCNGHYTEPNIAH
IPGIKSWPGKQIHSHNYRVPDPFENEVVVVIGNFASGADISRDIAKVAKEVHIASRAREP
HTYEKISVPQNNLWMHSEIDTTHEDGSIVFKNGKVIFADSIVYCTGYKYNFPFLETNGYL
RIDEKRVEPLYKHVFPPALAPGLAFVGLPAMGIVFVMFEIQSKWVAAVLSGRVTLPSTDK
MMEDINAWYASLDALGIPKRHTHTIGRIQSEYLNWVAKESGCELVERWRGQEVDGGYLRL
VAHPETYRDEWDDDELIEEAYNDFSRKKLISVDPSYYLENGR

www.000webhost.com

Other information
Ka divergence:0.0881897KaKs divergence:0.0890704
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1374Length 2 (bp):1389Length divergence:0.005
MFE 1 (kcal):-430.86MFE 2 (kcal):-426.32MFE divergence-0.005