Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G63300-AT5G41140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Myosin heavy chain-related protein
Function (paralog2):Myosin heavy chain-related protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.5816502648384
Log2 mRNA fold difference:4.0900235224286
Log2 TE fold difference:-1.6453588929483
Sequences
Protein sequence

MFKSARWRSEKNRIKVVFRLKFHATQASQFNTEGLILSLVPGDIGKPTARSEKAIVNDGH
CRWEIPVYETVKFLKDVKTGKVNQRIYHLIVSTTGSARGGLVGETSIDFADYVDATKTCN
VSLPLQNSSSKALLHVSIQRQLEFDDPQRDVDECETPVKMSQGLDLKSHFSIGDADENRK
SDSHEEGPFGKAARFAELRRRASIESDSTMSSSGSVIEPNTPEEVAKPLRHPTKHLHSAK
SLFEEPSRISESEWSGSSDHGISSTDDSTNSSNDIVARDTAINSSDEDEVEKLKNELVGL
TRQADLSELELQSLRKQIVKETKRSQDLLREVNSLKQERDSLKEDCERQKVSDKQKGETK
TRNRLQFEGRDPWVLLEETREELDYEKDRNFNLRLQLEKTQESNSELILAVQDLEEMLEE
KSKEGADNIEESMRRSCRSETDEDDHDQKALEDLVKKHVDAKDTHILEQKITDLYNEIEI
YKRDKDELEIQMEQLALDYEILKQQNHDISYKLEQSQLQEQLKIQYECSSSLVDVTELEN
QVESLEAELKKQSEEFSESLCRIKELESQMETLEEEMEKQAQVFEADIDAVTRGKVEQEQ
RAIQAEETLRKTRWKNASVAGKLQDEFKRLSEQMDSMFTSNEKMAMKAMTEANELRMQKR
QLEEMIKDANDELRANQAEYEAKLHELSEKLSFKTSQMERMLENLDEKSNEIDNQKRHEE
DVTANLNQEIKILKEEIENLKKNQDSLMLQAEQAENLRVDLEKTKKSVMEAEASLQRENM
KKIELESKISLMRKESESLAAELQVIKLAKDEKETAISLLQTELETVRSQCDDLKHSLSE
NDLEMEKHKKQVAHVKSELKKKEETMANLEKKLKESRTAITKTAQRNNINKGSPVGAHGG
SKEVAVMKDKIKLLEGQIKLKETALESSSNMFIEKEKNLKNRIEELETKLDQNSQEMSEN
ELLNGQENEDIGVLVAEIESLRECNGSMEMELKEMRERYSEISLRFAEVEGERQQLVMIV
RNLKNAKRS

MFKSSRWRSEKSNKIKIVFKLQFHATQVTQLKAEGLTISVVPGDVGKSTGKAEKAMVLDG
HCRWESPVYETVKFLQDVKTGKVNQRIYHLVMSTTGSTKSGVVGETSIDFADYVDAIKTC
NVSLPLQNSNSKAMLHVAIQRQLENADPQRVVKESDSLVKRSRGQDLKSHLSIEADESHK
SDSQEEGPFGKASRITELRRRASIESDSTLSSFDSVSELDTLGEVEIRGDHIQQNHSTMH
HHSVRNVYEEPHISESEWSGSSDQGISTDDSMNSSNDTIPRDTTRTSSDNEVDKLKAELG
ALARRTDLSELELQSLRKQIVKETKRSQDLLREVTSLKQERDLLKADNESNKASDKRKEE
AKIRNKLQLEGRDPHVLLEETREELDYEKDLNSNLRLQLQKTQESNTELILAVQDLEAME
GQRTKKTVDLPGPRTCERNTEESRRMSCTSETDDDEDQKALDELVKGHMDAKEAHVLERR
ITDLYNEIEIYKRDKEDLEIQVEQLSLDYEILKQENHDISYKLEQSQVQEQLKMQYECSS
SLVNVNELENHVESLEAKLKKQYKECSESLYRIKELETQIKGMEEELEKQAQIFEGDIEA
VTRAKVEQEQRAIEAEEALRKTRWKNASVAGKIQDEFKRISEQMSSTLAANEKVTMKAMT
ETRELRMQKRQLEELLMNANDELRVNRVEYEAKLNELSGKTDLKTKEMKRMSADLEYQKR
QKEDVNADLTHEITRRKDEIEILRLDLEETRKSSMETEASLSEELQRIIDEKEAVITALK
SQLETAIAPCDNLKHSLSNNESEIENLRKQVVQVRSELEKKEEEMANLENREASADNITK
TEQRSNEDRIKQLEGQIKLKENALEASSKIFIEKEKDLKNRIEELQTKLNEVSQNSQETD
ETLQGPEAIAMQYTEVLPLSKSDNLQDLVNEVASLREQNGLMETELKEMQERYSEISLRF
AEVEGERQQLVMTVRYLKNAKKR

Other information
Ka divergence:0.0493687KaKs divergence:0.229028
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):3090Length 2 (bp):2952Length divergence:-0.023
MFE 1 (kcal):-837.9MFE 2 (kcal):-816.29MFE divergence-0.013