Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G63350-AT1G63360
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Disease resistance protein (CC-NBS-LRR class) family
Function (paralog2):Disease resistance protein (CC-NBS-LRR class) family

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.3929186308923
Log2 mRNA fold difference:2.2665182702301
Log2 TE fold difference:-0.039143871819292
Sequences
Protein sequence

MGISFSIPFDPCVNKVSQWLDMKVSYTHNLEKNLVALETTMEELKAKRDDLLRKLKREED
RGLQTLGEIKVWLNRVETIESRVNDLLNARNAELQRLCLCGFCSKSLTTSYRYGKSVFLK
LREVEKLERRVFEVISDQASTSEVEEQQLQPTIVGQETMLDNAWNHLMEDGVGIMGLYGM
GGVGKTTLLTQINNKFSKYMCGFDSVIWVVVSKEVNVENILDEIAQKVHISGEKWDTKYK
YQKGVYLYNFLRKMRFVLFLDDIWEKVNLVEIGVPFPTIKNKCKVVFTTRSLDVCTSMGV
EKPMEVQCLADNDAYDLFQKKVGQITLGSDPEIRELSRVVAKKCCGLPLALNVVSETMSC
KRTVQEWRHAIYVLNSYAAKFSGMDDKILPLLKYSYDSLKGEDVKMCLLYCALFPEDAKI
RKENLIEYWICEEIIDGSEGIDKAENQGYEIIGSLVRASLLMEEVELDGANIVCLHDVVR
EMALWIASDLGKQNEAFIVRASVGLREILKVENWNVVRRMSLMKNNIAHLDGRLDCMELT
TLLLQSTHLEKISSEFFNSMPKLAVLDLSGNYYLSELPNGISELVSLQYLNLSSTGIRHL
PKGLQELKKLIHLYLERTSQLGSMVGISCLHNLKVLKLSGSSYAWDLDTVKELEALEHLE
VLTTTIDDCTLGTDQFLSSHRLMSCIRFLKISNNSNRNRNSSRISLPVTMDRLQEFTIEH
CHTSEIKMGRICSFSSLIEVNLSNCRRLRELTFLMFAPNLKRLHVVSSNQLEDIINKEKA
HDGEKSGIVPFPKLNELHLYNLRELKNIYWSPLPFPCLEKINVMGCPNLKKLPLDSKSGK
HGGNGLIITHREMEWITRVEWEDEATKTRFLANRSSFSSSLICFSNDLVSRDMNCFHL

MGISFSIPFDPCVNKVSQWLDMKVSYTHNLEKNLAALEKTMKELKAKRDDLERRLKREEA
RGLQRLSEFQVWLDSVATVEDIIITLLRDRNVEIQRLCLCRFCSKSLTRSYRYGKSVFLR
LREVEKLKGEVFGVITEQASTSAFEERPLQPTIVGQDTMLDKAGKHLMEDGVGIMGMYGM
GGVGKTTLLTQLYNMFNKDKCGFDIGIWVVVSQEFHVEKVQDEIAQKLGLGGDEWTQKDK
SQKGICLYNILREKSFVLFLDDIWEKVDLAEIGVPDPRTKKGRKLAFTTRSQEVCARMGV
EHPMEVQCLEENVAFDLFQKKVGQTTLGSDPGIPQLARIVAKKCCGLPLALNVIGETMSC
KRTIQEWRHAIHVLNSYAAEFIGMEDKVLPLLKYSYDNLKGEQVKSSLLYCALYPEDAKI
LKEDLIEHWICEEIIDGSEGIEKAEDKGYEIIGCLVRASLLMEWDDGDGRRAVCMHDVVR
EMALWIASELGIQKEAFIVRAGVGVREIPKIKNWNVVRRMSLMENKIHHLVGSYECMELT
TLLLGKREYGSIRSQLKTISSEFFNCMPKLAVLDLSHNKSLFELPEEISNLVSLKYLNLL
YTEISHLPKGIQELKKIIHLNLEYTRKLESITGISSLHNLKVLKLFRSRLPWDLNTVKEL
ETLEHLEILTTTIDPRAKQFLSSHRLLSHSRLLEIYGSSVSSLNRHLESLSVSTDKLREF
QIKSCSISEIKMGGICNFLSLVDVNIFNCEGLRELTFLIFAPKIRSLSVWHAKDLEDIIN
EEKACEGEESGILPFPELNFLTLHDLPKLKKIYWRPLPFLCLEEINIRECPNLRKLPLDS
TSGKQGENGCIIRNKDSRWFEGVKWADEATKKRFLPSCQLISLK

www.000webhost.com

Other information
Ka divergence:0.174805KaKs divergence:0.39207
GC content 1 (%):39GC content 2 (%):40GC content divergence:0.013
Length 1 (bp):2697Length 2 (bp):2655Length divergence:-0.008
MFE 1 (kcal):-768.9MFE 2 (kcal):-768.02MFE divergence-0.001