Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G63430-AT5G41180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):leucine-rich repeat transmembrane protein kinase family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.131152926962
Log2 mRNA fold difference:-1.1997442737344
Log2 TE fold difference:0.048075624162739
Sequences
Protein sequence

MRSKYFCSLALVLGLFFVSCDGFASNEVQALRRFKEAIYEDPLLVMSNWNDPNSDPCDWT
GIYCSPSKDHVIKINISASSIKGFLAPELGQITYLQELILHGNILIGTIPKEIGNLKNLK
ILDLGNNHLMGPIPAEIGSLSGIMIINLQSNGLTGKLPAELGNLKYLRELHIDRNRLQGS
LLVAGASGYQSKVYSSNSSANIAGLCKSLKVADFSYNFFVGNIPKCLENLPRTSFQGNCM
QNKDLKHRSSSQCANAQLVKTHGSPSAAPKHQSAQMVAKHHRASKPKWLLALEIVTGSMV
GLLLLVALFSAVHRWNNRSTLIIPWKKSSSEKEKFTVYVDSEMLKDVSRLTRQELEVACE
DFSNIIGLSADSQIYKGTLKGGSEIAVISLCVKEEDWTGYLELYFQREVADLARLNHENT
AKLLGYCKEISPFTRMLVFEYASNGTLYEHLHYGEAALVSWARRMKIVIGIARGLKYLHM
ELDPPFTISELSSNAIYLTEDFTPKLVDFECWKTILARSEKNLRNISSQGSICVLPNGME
SRYLDVSGNIYAFGILLLEIVSGRPPYCKDKGFLIEWLYRTSNVVFVAKVLNLKRIYCIL
QAKEFLEAPEAMSGLVDPELKHFNQEDLETVCEVASQCLNRDPTNNNNNHNKPSVQELCE
TLESRISLSISAELRSSSLAWAELALDS

MRLYLSSTMQLSLMSLVLGFLFVSCDAFASKEVEAVRRFKEAIYKDPLLVMSNWNVPNLS
PCDWNGIKCSPSKDHIIKINISGTSMRGFLVPELGQITYLQELILRGNILMGTIPKEIGK
LKKLKILDLGNNHLTGPIPAEIGKLSRIKTINLQSNGLIGKLPPEIGNLKHLKELLIGRN
RLRGSIPIAAKTSKKYASNPSANISGLCKSSLFKVADFSYNFFEGRVPSCLDYLPITSFQ
GNCMKTMDVKQRPLSECARLAVTVAKKKHRASRQTWLRNFEIVTGSSVGLLFLVVMFSAC
SLCKIKRSLIVPWKKSASEKEKFTVYVDSEMLKDVSRYTRQELEVACEDFSNIIDSSAES
QIYKGTIKGGTEIAVISLCVKEENWTGYLELNFQREVAALARLNHENAGKLLGYCKESTP
FTRMLVFEYASNGTLYDHLHYADGSLVSWAKRMKIVIGIARGLKYLHTELHPPFTVSELS
STAVYLTEDFTPKLVDFECWKIIQVRSEKNLKNICNEGAICVLPNAMEHRDMDLQGNIYS
FGILLLEIVSGRPSYCQDRGCLVEWVREKNLGAPDVMASLVDPELKHFKQKELEAVCEVA
SQCLNLDQNEKDKDKLSCSIQALCETLESRITVSISAEFKSSSLAWAELALASPSNEDDD
DRSK

www.000webhost.com

Other information
Ka divergence:0.3998KaKs divergence:0.309637
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2067Length 2 (bp):1995Length divergence:-0.018
MFE 1 (kcal):-590.82MFE 2 (kcal):-588MFE divergence-0.002