Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G63470-AT1G63480
Species:Arabidopsis
Duplication type:TD
Function (paralog1):AT hook motif DNA-binding family protein
Function (paralog2):AT hook motif DNA-binding family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.99847678198167
Log2 mRNA fold difference:-1.119121090055
Log2 TE fold difference:0.19890577619727
Sequences
Protein sequence

MDGREAMAFPGSHSQFYLQRGVFTNLTPSQVASGLHAPPPPPGMRPMSNPNIHHPQASNP
GPPFSMAEHRHSDFGHSIHMGMASPAAVQPTLQLPPPPSEQPMVKKKRGRPRKYVPDGQV
SLGLSPMPCVSKKSKDSSSMSDPNAPKRARGRPPGTGRKQRLANLGEWMNTSAGLAFAPH
VISVGSGEDIVSKVLSFSQKRPRALCIMSGTGTVSSVTLREPASTTPSLTFEGRFEILSL
GGSYLVNEEGGSKSRTGGLSVSLSGPEGHVIGGGIGMLIAASLVQVVACSFVYGASAKSN
NNNNKTIKQEIKPKQEPTNSEMETTPGSAPEAAASTGQHTPQNFPAQGMSGWPVSGSGSG
RSLDSSRNPLTDIDLTRG

MDGREAMAFPGSHSQYYLQRGAFTNLAPSQVASGLHAPPPHTGLRPMSNPNIHHPQANNP
GPPFSDFGHTIHMGVVSSASDADVQPPPPPPPPEEPMVKRKRGRPRKYGEPMVSNKSRDS
SPMSDPNEPKRARGRPPGTGRKQRLANLGEWMNTSAGLAFAPHVISIGAGEDIAAKVLSF
SQQRPRALCIMSGTGTISSVTLCKPGSTDRHLTYEGPFEIISFGGSYLVNEEGGSRSRTG
GLSVSLSRPDGSIIAGGVDMLIAANLVQVVACSFVYGARAKTHNNNNKTIRQEKEPNEED
NNSEMETTPGSAAEPAASAGQQTPQNFSSQGIRGWPGSGSGSGRSLDICRNPLTDFDLTR
G

www.000webhost.com

Other information
Ka divergence:0.15495KaKs divergence:0.702511
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):1137Length 2 (bp):1086Length divergence:-0.023
MFE 1 (kcal):-377.29MFE 2 (kcal):-343.86MFE divergence-0.046