Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G63500-AT5G41260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase protein with tetratricopeptide repeat domain
Function (paralog2):Protein kinase protein with tetratricopeptide repeat domain

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.5465988935366
Log2 mRNA fold difference:-1.3579182529249
Log2 TE fold difference:-0.17756392243228
Sequences
Protein sequence

MGCEVSKLCAFCCVSDPEGSNHGVTGLDEDRRGEGNDLPQFREFSIETLRNATSGFATEN
IVSEHGEKAPNVVYKGKLDNQRRIAVKRFNRKAWPDSRQFLEEAKAVGQLRNYRMANLLG
CCYEGEERLLVAEFMPNETLAKHLFHWESQPMKWAMRLRVALHIAQALEYCTGKGRALYH
DLNAYRVLFDDDSNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVMYSYGT
LLLDLLSGKHIPPSHALDLIRDRNIQMLIDSCLEGQFSSDDGTELIRLASRCLQYEPRER
PNPKSLVTAMIPLQKDLETPSHQLMGIPSSASTTPLSPLGEACLRTDLTAIHEILEKLSY
KDDEGAATELSFQMWTNQMQDSLNFKKKGDVAFRHKEFANAIDCYSQFIEGGTMVSPTVY
ARRSLCYLMNEMPQEALNDAMQAQVISPAWHIASYLQAVALSALGQENEAHAALKDGSML
ESKRNRL

MGCEVSKLSALCCVSESGRSNPDVTGLDEEGRGESNDLPQFREFSIETIRNATSGFAAEN
IVSEHGERAPNVVYKGKLENQRRIAVKRFNRKSWPDSRQFLEEAKAVGQLRNHRMANLLG
CCYEDEERLLIAEFMPNETLAKHLFHWESQPMKWAMRLRVALHIAQALEYCTSKGRALYH
DLNAYRVLFDDDANPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVIYSFGT
LLLDLLSGKHIPPSHALDLIRDRNIQMLMDSGLEGQFSSDDGTELIRLASRCLQYEPRER
PNPKSLVSAMIPLQKDLEIASHQLLGVPNSATTTALSPLGEACLRSDLTAIHEIIEKLGY
KDDEGATTELSFQMWTDQMQDTLVFKKKGDSAFRHKDFAKAIECYSQFIEVGTMGSPTVH
ARQSLCYLMNDMPREALNNAMQAQVISPAWHIASYLQAVALSALGQENEAHTALKDGAML
ESKRNPL

www.000webhost.com

Other information
Ka divergence:0.194088KaKs divergence:0.499321
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1464Length 2 (bp):1464Length divergence:0
MFE 1 (kcal):-427.32MFE 2 (kcal):-426.63MFE divergence-0.001