Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G63800-AT5G41340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ubiquitin-conjugating enzyme 5
Function (paralog2):ubiquitin conjugating enzyme 4

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.62691925111047
Log2 mRNA fold difference:-0.14841035756759
Log2 TE fold difference:-0.3572336104414
Sequences
Protein sequence

MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYP
YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL
NGEAAALMMRDRPTYEQRVKEYCEKYAKPRADTEEMSSDDEMSEDEYASDGDDEDDVAIA
GKLDP

MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP
YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL
NGEAAALMMRDRPAYEQRVKEYCEKYAKPGEGSEDKSSDEELSEEEYGSDNEDDDDDDVA
IAGKPDP

www.000webhost.com

Other information
Ka divergence:-0.292411KaKs divergence:-0.454209
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):558Length 2 (bp):564Length divergence:0.005
MFE 1 (kcal):-146.32MFE 2 (kcal):-147.51MFE divergence0.004