Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G63820-AT5G41380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CCT motif family protein
Function (paralog2):CCT motif family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.3881679087462
Log2 mRNA fold difference:1.5841470123587
Log2 TE fold difference:-0.23594956224325
Sequences
Protein sequence

MDSDLYIFDGSSSSSSICHSTDPDMFSSDTTTTTDLYCNNPYLNPSMDDHQSLSFFESFT
PTTHHILSSSPPISQLQTLTLTHTNSFPNFSGFENFDTVKTEQLLFNSPFDAPFMEDSSN
FQNQNLLNSPEDSFFSDHMRRVYSTGDLQNLGRDFTGQRSYSSPLAAESSPTTVFSGDEQ
SLRVGRYSSEERKEKISKYRAKRTQRNFTKTIKYACRKTLADNRPRVRGRFARNDEVFEN
PKIASSFTRQENDDDLWNLDGLHEEEEACVNLVECQSQSQPQLQMQYMTNSYW

MDSSTDFYIFDGSSSSSSSVFRNSSPDMFSSDTTTTTDLFCNNELYSVEESLNIFDHFTP
QHILSSSPPSDLLGTLSLSQHIPTGLYPNFSDFQISDAVKTEKFFDGHNQAATMARSYST
IENSGRYMQRSFSSNSVEGKQTQVPFNIPMMDSSNLSYNNLSSPENAFFSSQMRRVYSTG
DLQNNMEMQRSSENSTMPFSEEQNFKVGRYSAEERKEKISKYRAKRNQRNFTKTIKYACR
KTLADSRPRIRGRFARNDEVVEIPNIEDDDSELWKLDGLHEKEEASVSSFVVQQPLLHYT
TSSSFFW

www.000webhost.com

Other information
Ka divergence:-0.141999KaKs divergence:-0.752426
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):882Length 2 (bp):924Length divergence:0.023
MFE 1 (kcal):-224.95MFE 2 (kcal):-232.76MFE divergence0.017