Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G63830-AT5G41390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PLAC8 family protein
Function (paralog2):PLAC8 family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.5554248252144
Log2 mRNA fold difference:-3.1135925268527
Log2 TE fold difference:-0.11396114774547
Sequences
Protein sequence

MAASQDKLDKMKLRQDYRNLWHSDLMGTVTADTPYCCISCLCGPCVSYMLRRRALYNDMS
RYTCCAGYMPCSGRCGESKCPQLCLATEVFLCFGNSVASTRFLLQDEFNIQTTQCDNCII
GFMFCLSQVACIFSIVACIVGSDELSEASQILSCCADMVYCTVCACMQTQHKLEMDKRDG
VFGSQPMGVPPAQQMSRFDQPVPPPVGYPQSYPPPAQGYPPASYPPPGYPQH

MARSQDKLDKMQLRQSYRNLWHSDLMGTVSADTPYCFFSCLCGPCVSYLLRKRALYNDMS
RYTCCGGYMPCSGKCGESKCPQFCLATEVCLCFGNSVASTRFMLQDEFNIHTTKCDNCII
GFMFCLNQIACIFSLVACIVGSDELSEASQLLSCLADMVYCTVCACMQTQHKIEMDKRDG
LISPQPMSVPPAQQMSRIDQPVPPYAGYPPATGYPQHYYPQPGHGYPPAPGYPPPGHGYP
PAPGYPPAPGYPSGYPPAPGYPSK

www.000webhost.com

Other information
Ka divergence:0.171104KaKs divergence:-0.0780969
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):699Length 2 (bp):795Length divergence:0.064
MFE 1 (kcal):-214.61MFE 2 (kcal):-240.35MFE divergence0.057