Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64170-AT5G41610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cation/H+ exchanger 16
Function (paralog2):cation/H+ exchanger 18

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.91591807665742
Log2 mRNA fold difference:-0.10044867180276
Log2 TE fold difference:-0.77140814887634
Sequences
Protein sequence

MGTLVNGTIPAMKCPKNVAMMKTTSNGVFDGESPLDFAFPLVILQICLVVAVTRSLAFLL
RPMRQPRVVAEIIGGILLGPSALGRITSYKNSIFPARSLTVLDTLANLGLLLFLFLVGLE
IDLTSLRRTGKKAISIAAAGMLLPFGMGIVTSFAFPEASSSGDNSKVLPFIIFMGVALSI
TAFGVLARILAELKLLTTDLGRISMNAAAINDVAAWVLLALAVSLSGDRNSPLVPLWVLL
SGIAFVIACFLIVPRIFKFISRRCPEGEPIGEMYVCVALCAVLLAGFATDAIGIHAIFGA
FVMGVLFPKGHFSDAIVEKIEDLVMGLLLPLYFVMSGLKTDITTIQGVKSWGRLALVIVT
ACFGKIVGTVSVALLCKVRLRESVVLGVLMNTKGLVELIVLNIGKDRKVLSDQTFAIMVL
MAIFTTFITTPIVLALYKPSETTQTHSSVSYKNRKHRRKIENDEEGEKMQQLKVLVCLQS
SKDIDPMMKIMEATRGSNETKERFCVYVMHLTQLSERPSSIRMVQKVRSNGLPFWNKKRE
NSSAVTVAFEASSKLSSVSVRSVTAISPLSTIHEDICSSADSKCTAFVILPFHKQWRSLE
KEFETVRSEYQGINKRVLENSPCSVGILVDRGLGDNNSPVASSNFSLSVNVLFFGGCDDR
EALVYGLRMAEHPGVNLTVVVISGPESARFDRLEAQETSLCSLDEQFLAAIKKRANAARF
EERTVNSTEEVVEIIRQFYECDILLVGKSSKGPMVSRLPVMKIECPELGPVGNLIVSNEI
STSVSVLVVQQYTGKGPSVVGSVSVPVVETP

MATNSTKACPAPMKATSNGVFQGDNPIDFALPLAILQIVIVIVLTRVLAYLLRPLRQPRV
IAEVIGGIMLGPSLLGRSKAFLDAVFPKKSLTVLETLANLGLLFFLFLAGLEIDTKALRR
TGKKALGIALAGITLPFALGIGSSFVLKATISKGVNSTAFLVFMGVALSITAFPVLARIL
AELKLLTTEIGRLAMSAAAVNDVAAWILLALAIALSGSNTSPLVSLWVFLSGCAFVIGAS
FIIPPIFRWISRRCHEGEPIEETYICATLAVVLVCGFITDAIGIHSMFGAFVVGVLIPKE
GPFAGALVEKVEDLVSGLFLPLYFVASGLKTNVATIQGAQSWGLLVLVTATACFGKILGT
LGVSLAFKIPMREAITLGFLMNTKGLVELIVLNIGKDRKVLNDQTFAIMVLMALFTTFIT
TPVVMAVYKPARRAKKEGEYKHRAVERENTNTQLRILTCFHGAGSIPSMINLLEASRGIE
KGEGLCVYALHLRELSERSSAILMVHKVRKNGMPFWNRRGVNADADQVVVAFQAFQQLSR
VNVRPMTAISSMSDIHEDICTTAVRKKAAIVILPFHKHQQLDGSLETTRGDYRWVNRRVL
LQAPCSVGIFVDRGLGGSSQVSAQDVSYSVVVLFFGGPDDREALAYGLRMAEHPGIVLTV
FRFVVSPERVGEIVNVEVSNNNNENQSVKNLKSDEEIMSEIRKISSVDESVKFVEKQIEN
AAVDVRSAIEEVRRSNLFLVGRMPGGEIALAIRENSECPELGPVGSLLISPESSTKASVL
VIQQYNGTGIAPDLGAAETEVLTSTDKDSD

www.000webhost.com

Other information
Ka divergence:-0.387713KaKs divergence:-0.0784091
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):2436Length 2 (bp):2433Length divergence:-0.001
MFE 1 (kcal):-805.09MFE 2 (kcal):-766.46MFE divergence-0.025