Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64180-AT5G41620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):intracellular protein transport protein USO1-related
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.27799582045307
Log2 mRNA fold difference:-0.48736305829196
Log2 TE fold difference:0.21740944126549
Sequences
Protein sequence

MKSKEEEEEEEEEDDGGEGQKGKRFIEKLRRRAVFVGHRSVFRRPSTPVHISFNPNKNPS
SASSRKLAASLWEFYQYYDNDHLIHPPAATKMHRAPLGSAGPSNSRRLRHGHGKAAVADN
NGIELTDHQPESAGSIRRQIGQMLMKHHHLTERNDHALQPVSPTSYDSSLEFRGRRRAGE
PNNNIKTSTELLKVLNRIWILEEQHSANISLIKSLKTELAHSRARIKDLLRCKQADKRDM
DDFVKQLAEEKLSKGTKEHDRLSSAVQSLEDERKLRKRSESLYRKLAQELSEVKSTLSNC
VKEMERGTESKKILERLCDEFAKGIKSYEREIHGLKQKLDKNWKGWDEQDHMILCIAESW
LDERIQSGNGSALEKLEFEIETFLKTNQNADSNEIARNRRTSLESVPFNAMSAPIWEVDR
EEEEDSGGSGSNCFELKKHGSDVAKPPRGDETEKPELIKVGVSERPQRRSQSPSSLQVKF
EDQMAWAMSSNEKKKTRANEMEPETEKCGKETNNVVGEMIRTHRRLSSETREIDEASCSY
PSRRRESPIRQWNTRTVTPDLGAPRGVKDNTLKTKLSEARTTSSRPRVRLFKD

MESKVRGEEERQKVERLVEKLKVHNNNNNRSSTPAHISFVPNSIVVSSRKLAAAFWEFHQ
YHYKDEEDCSYSYLSSASAKMHRGPNGFAGASSRRQRHGKAVAVKENGLDLSQFLRDPSP
DHQPDSAGSLRRQIGQMLIKHHQSIDRNNHALQPVSPASYGSSLEVTTYNKAVTPSSSLE
FRGRPSREPHYNLKTSTELLKVLNRIWSLEEQHVSNISLIKALKTEVAHSRVRIKELLRY
QQADRHELDSVVKQLAEEKLLSKNKEVERMSSAVQSVRKALEDERKLRKRSESLHRKMAR
ELSEVKSSLSNCVKELERGSKSNKMMELLCDEFAKGIKSYEEEIHGLKKKNLDKDWAGRG
GGDQLVLHIAESWLDERMQMRLEGGDTLNGKNRSVLDKLEVEIETFLQEKRNEIPRNRRN
SLESVPFNTLSAPPRDVDCEEDSGGSDSNCFELKKPAESYGDETKKPNQHNKDGSIDEKP
KSPSSFQVNFEDQMAWALSSNGKKKTTRAIEDEEEEEDVKPENSNNNKKPENECATTNKN
DVMGEMIRTHRRLLSETREIDEASCNFPSSRRQASPVRQWISRTVAPDLLGPSEIAIAHG
VKDNTLKTKLANSSKSRLRLFKG

Other information
Ka divergence:-0.0586925KaKs divergence:-0.0152305
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1782Length 2 (bp):1872Length divergence:0.025
MFE 1 (kcal):-517.05MFE 2 (kcal):-553.21MFE divergence0.034