Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64185-AT5G41650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Lactoylglutathione lyase / glyoxalase I family protein
Function (paralog2):Lactoylglutathione lyase / glyoxalase I family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.5646858902462
Log2 mRNA fold difference:-0.83141830779469
Log2 TE fold difference:-0.7329689795394
Sequences
Protein sequence

MATASFRWILQLHRDVPKAARFYEKGLDFSVNVVTLRWAELQSGPLKLALMQAPSEHVMS
EKGYSSLLSFTVADINTTISKLMELGAELDGSIKYEVHGKVASVRCLDGHVLGLYEPS

MATASFRWILQLHRDVPKAARFYAQGLDFSVNVVTLRWAELHSGPIKLALMQSPSNHVAE
KGYSSLLSFTVTDINTTVTKLMALGAELDGTIKYEIHGKVAAMKCPDGYMLGLYEAA

Other information
Ka divergence:-0.23017KaKs divergence:-0.00200401
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):357Length 2 (bp):354Length divergence:-0.004
MFE 1 (kcal):-99.8MFE 2 (kcal):-107.69MFE divergence0.038