Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64190-AT5G41670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):6-phosphogluconate dehydrogenase family protein
Function (paralog2):6-phosphogluconate dehydrogenase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.37332967801398
Log2 mRNA fold difference:1.0785387914435
Log2 TE fold difference:-1.4478388180305
Sequences
Protein sequence

MESAALSRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAAVEGNLPVSGQ
YSPRDFVLSIQRPRSLIILVKAGAPVDQTIDAFSEYMEPGDCIIDGGNEWYQNTERRISE
AEQKGLLYLGMGVSGGEEGARNGPSLMPGGSFQAYDNIKDILEKVAAQVEDGPCVTYIGE
GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNEELAEIFTEWNSGELESFLVEIT
SDIFRVKDEFGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKD
ERENAAKVLREAGLKEEIGSASSGIDKKRLVDDVRQALYASKICSYAQGMNLLRAKSLEK
SWNLNFGELARIWKGGCIIRAVFLDRIKKAYQRNPDLASLVVDPEFAKEMVQRQAAWRRV
VGLAVSAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERTDRPGAYHTEWT
KLARKNH

MESVALSRIGLAGLAVMGQNLALNIADKGFPISVYNRTTSKVDETLDRASNEGKLPVAGQ
YSPRDFVLSIQRPRSVIILVKAGAPVDQTISALSEYMEPGDCIIDGGNEWYQNTERRIVE
AEKKGLLYLGMGVSGGEEGARNGPSLMPGGSFTAYNNVKDILEKVAAQVEDGPCVTYIGE
GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNDELAEIFTEWNRGELESFLVEIT
SDIFRVKDDYGDGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKD
ERENAAKVLEEAGLKEDIGSASRGVDKKRLIDDVRQALYASKICSYAQGMNLLRAKSLEK
GWDLNLGEMARIWKGGCIIRAVFLDRIKKAYQRNPNLASLVVDPDFAKEMVQRQAAWRRV
VGLAISAGISTPGMCASLAYFDTYRRARLPANLVQAQRDLFGAHTYERTDRPGAYHTEWT
KLARKSQ

Other information
Ka divergence:0.00125892KaKs divergence:-0.0661896
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1464Length 2 (bp):1464Length divergence:0
MFE 1 (kcal):-489.47MFE 2 (kcal):-458.71MFE divergence-0.032