Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64210-AT5G41680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.123721923153
Log2 mRNA fold difference:1.1073127835487
Log2 TE fold difference:0.16752184416793
Sequences
Protein sequence

MQIFLFFFSLILCFVLISSQTLEDDKKALLHFLSSFNSSRLHWNQSSDVCHSWTGVTCNE
NGDRIVSVRLPAVGFNGLIPPFTISRLSSLKFLSLRKNHFTGDFPSDFTNLKSLTHLYLQ
HNHLSGPLLAIFSELKNLKVLDLSNNGFNGSIPTSLSGLTSLQVLNLANNSFSGEIPNLH
LPKLSQINLSNNKLIGTIPKSLQRFQSSAFSGNNLTERKKQRKTPFGLSQLAFLLILSAA
CVLCVSGLSFIMITCFGKTRISGKLRKRDSSSPPGNWTSRDDNTEEGGKIIFFGGRNHLF
DLDDLLSSSAEVLGKGAFGTTYKVTMEDMSTVVVKRLKEVVVGRREFEQQMEIIGMIRHE
NVAELKAYYYSKDDKLAVYSYYNHGSLFEILHGNRGRYHRVPLDWDARLRIATGAARGLA
KIHEGKFIHGNIKSSNIFLDSQCYGCIGDVGLTTIMRSLPQTTCLTSGYHAPEITDTRRS
TQFSDVYSFGVVLLELLTGKSPVSQAELVPTGGENMDLASWIRSVVAKEWTGEVFDMEIL
SQSGGFEEEMVEMLQIGLACVALKQQERPHIAQVLKLIEDIRSVDAE

MMACCLRNKRRMKGKLSWKSKKRDLSHSGNWAPEDDNDEGKIVFFGGSNYTFDLDDLLAA
SAEILGKGAHVTTYKVAVEDTATVVVKRLEEVVVGRREFEQQMEIVGRIRHDNVAELKAY
YYSKIDKLAVYSYYSQGNLFEMLHGKLSFCIPLSMLLWYAVSKTNNSTFAGESQVPLDWE
SRLRIAIGAARGLAIIHEADDGKFVHGNIKSSNIFTNSKCYGCICDLGLTHITKSLPQTT
LRSSGYHAPEITDTRKSTQFSDVYSFGVVLLELLTGKSPASPLSLDENMDLASWIRSVVS
KEWTGEVFDNELMMQMGIEEELVEMLQIGLACVALKPQDRPHITHIVKLIQDIPTNFNL

Other information
Ka divergence:0.247807KaKs divergence:0.206897
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1764Length 2 (bp):1080Length divergence:-0.241
MFE 1 (kcal):-530.99MFE 2 (kcal):-309.2MFE divergence-0.264