Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64220-AT5G41685
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):translocase of outer membrane 7 kDa subunit 2
Function (paralog2):Mitochondrial outer membrane translocase complex, subunit Tom7

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.6384283923078
Log2 mRNA fold difference:3.3279975624089
Log2 TE fold difference:-0.93052014019227
Sequences
Protein sequence

MAAKSTLKIKGKAKPSKGSSSSSSSSASSKYKVFKDWTNWSLQKAKVATHYGFIPLIIII
GMNSDPKPHLFHLLSPV

MESTISLKVNKGKGKGSKGASSSDDKSKFDVVKEWTNWSLKKAKVVTHYGFIPLVIFVGM
NSDPKPHLFQLLSPV

www.000webhost.com

Other information
Ka divergence:-0.434338KaKs divergence:-0.742936
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):234Length 2 (bp):228Length divergence:-0.013
MFE 1 (kcal):-45.58MFE 2 (kcal):-58MFE divergence0.12