Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64300-AT5G41730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase family protein
Function (paralog2):Protein kinase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.3459120263425
Log2 mRNA fold difference:1.7746915157257
Log2 TE fold difference:0.45279147552907
Sequences
Protein sequence

MEQFRQIGEVLGSLNALMVLQDDILINQRQCCLLLDIFSLGFNTVAEEIRHNLKLEEKHT
KWRALEQPLRELYRVFKEGEMYVRNCMSNKDWWGKVINFHQNKDCVEFHIHNLLCYFSAV
IEAIETAGEISGLDPSEMERRRVVFSRKYDREWNDPKLFQWRFGKQYLVPRDICLRFEHS
WREDRWNLVEALQEKRKSKSDEIGKTEKRLADFLLKKLTGLEQFNGKLFPSSILVGSKDY
QVRRRLGGGGQYKEIQWLGDSFVLRHFFGDLEPLNAEISSLLSLCHSNILQYLCGFYDEE
RKECSLVMELMHKDLKSYMKENCGPRRRYLFSVPVVIDIMLQIARGMEYLHSNEIFHGDL
NPMNILLKERSHTEGYFHAKISGFGLTSVKNQSFSRASSRPTTPDPVIWYAPEVLAEMEQ
DLKGTAPRSKFTHKADVYSFAMVCFELITGKVPFEDDHLQGDKMAKNIRTGERPLFPFPS
PKYLVSLIKRCWHSEPSQRPTFSSICRILRYIKKFLVVNPDHGHLQIQNPLVDCWDLEAR
FLKKFSMESGSHAGSVTQIPFQLYSYRIAEKEKMSPNFNKEENSDAGESVSESVSVVEEP
PTTMPMYTKSLCLDAISEYSDTRSVYSEAPIKKTSALKKSGDTIKNRRNSISGLRSPGSS
PIKPRSTPKVSSPLSPFGRSSSNKANKDTRLPLSPMSPLSHGRRRQLTGPASDSELT

MEQFRQIGEVLGSLNALMVLQDDILINQRQCCLLLELFSLAFNTVAEEIRQNLKLEEKHT
KWRALEQPLRELYRVFKEGELYVKHCMDNSDWWGKVINLHQNKDCVEFHIHNLFCYFSAV
VEAIEAAGEISGLDPSEMERRRVVFSRKYDREWNDPKMFQWRFGKQYLLSRDICSRFEHS
WREDRWNLVEALQEKRKSDSDDIGKTEKRLADLLLKKLTGLEQFNGKLFPSSILLGSKDY
QVKKRLDADGQYKEIQWLGDSFALRHFFSDLEPLSSEISSLLALCHSNILQYLCGFYDEE
RKECFLVMELMHKDLQSYMKENCGPRRRYLFSIPVVIDIMLQIARGMEYLHGNDIFHGDL
NPMNIHLKERSHTEGYFHAKICGFGLSSVVKAQSSSKPGTPDPVIWYAPEVLAEMEQDLN
GKTPKSKLTHKADVYSFAMVCFELITGKVPFEDSHLQGEPMTINIRMGERPLFPFPSPKY
LVSLIKRCWHSEPSQRPNFSSICRILRYIKKFLVVNPDHGHPQMQTPLVDCWDLEARFLR
KFPGDAGSHTASVNQIPFQLYSYRVLEKEKMNPNSKESSETSESESVSVVEDPPNAMITR
DTKSLCLDTISEYSDTRSVYSEAPMKKVSALKKSGEMAKLRRSPSLGSEKLRSAGTSTVK
ARSSPKVSPLSPFGRSIKARKDNRLPLSPMSPLTPGIRRQQTGHASDSELT

www.000webhost.com

Other information
Ka divergence:-0.021391KaKs divergence:-0.349638
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):2154Length 2 (bp):2136Length divergence:-0.004
MFE 1 (kcal):-628.63MFE 2 (kcal):-612.09MFE divergence-0.013