Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64330-AT5G41790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myosin heavy chain-related
Function (paralog2):COP1-interactive protein 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.443802665151
Log2 mRNA fold difference:0.85012664562608
Log2 TE fold difference:0.49646930030041
Sequences
Protein sequence

MRKLSIRDSLKSFFEPHLHPDNGESLKGTKTEIDEKVKKILGIVESGDIEEDESKRLVVA
ELVKDFYKEYESLYHQYDDLTGEIRKKVHGKGENDSSSSSSSDSDSDKKSKRNGRGENEI
ELLKKQMEDANLEIADLKMKLATTDEHKEAVESEHQEILKKLKESDEICGNLRVETEKLT
SENKELNEKLEVAGETESDLNQKLEDVKKERDGLEAELASKAKDHESTLEEVNRLQGQKN
ETEAELEREKQEKPALLNQINDVQKALLEQEAAYNTLSQEHKQINGLFEEREATIKKLTD
DYKQAREMLEEYMSKMEETERRMQETGKDVASRESAIVDLEETVESLRNEVERKGDEIES
LMEKMSNIEVKLRLSNQKLRVTEQVLTEKEGELKRIEAKHLEEQALLEEKIATTHETYRG
LIKEISERVDSTILNRFQSLSEKLEEKHKSYEKTVVEATKMLLTAKKCVVEMKKEKDEMA
KEKEEVEKKLEGQVREEEKEKEKLKETLLGLGEEKREAIRQLCIWIEHHRDRCEYLEEVL
SKMVVARGQRRSQRA

MKKHKFRETLKSFFEPHFDHEKGEMLKGTKTEIDEKVNKILGMVESGDVNEDESNRQVVA
DLVKEFYSEYQSLYRQYDDLTGEIRKKVNGKGESSSSSSSDSDSDHSSKRKVKRNGNGKV
EKDVELVTGALKQQIEAANLEIADLKGKLTTTVEEKEAVDSELELALMKLKESEEISSKL
KLETEKLEDEKSIALSDNRELHQKLEVAGKTETDLNQKLEDIKKERDELQTERDNGIKRF
QEAEKVAEDWKTTSDQLKDETSNLKQQLEASEQRVSELTSGMNSAEEENKSLSLKVSEIS
DVIQQGQTTIQELISELGEMKEKYKEKESEHSSLVELHKTHERESSSQVKELEAHIESSE
KLVADFTQSLNNAEEEKKLLSQKIAELSNEIQEAQNTMQELMSESGQLKESHSVKERELF
SLRDIHEIHQRDSSTRASELEAQLESSKQQVSDLSASLKAAEEENKAISSKNVETMNKLE
QTQNTIQELMAELGKLKDSHREKESELSSLVEVHETHQRDSSIHVKELEEQVESSKKLVA
ELNQTLNNAEEEKKVLSQKIAELSNEIKEAQNTIQELVSESGQLKESHSVKDRDLFSLRD
IHETHQRESSTRVSELEAQLESSEQRISDLTVDLKDAEEENKAISSKNLEIMDKLEQAQN
TIKELMDELGELKDRHKEKESELSSLVKSADQQVADMKQSLDNAEEEKKMLSQRILDISN
EIQEAQKTIQEHMSESEQLKESHGVKERELTGLRDIHETHQRESSTRLSELETQLKLLEQ
RVVDLSASLNAAEEEKKSLSSMILEITDELKQAQSKVQELVTELAESKDTLTQKENELSS
FVEVHEAHKRDSSSQVKELEARVESAEEQVKELNQNLNSSEEEKKILSQQISEMSIKIKR
AESTIQELSSESERLKGSHAEKDNELFSLRDIHETHQRELSTQLRGLEAQLESSEHRVLE
LSESLKAAEEESRTMSTKISETSDELERTQIMVQELTADSSKLKEQLAEKESKLFLLTEK
DSKSQVQIKELEATVATLELELESVRARIIDLETEIASKTTVVEQLEAQNREMVARISEL
EKTMEERGTELSALTQKLEDNDKQSSSSIETLTAEIDGLRAELDSMSVQKEEVEKQMVCK
SEEASVKIKRLDDEVNGLRQQVASLDSQRAELEIQLEKKSEEISEYLSQITNLKEEIINK
VKVHESILEEINGLSEKIKGRELELETLGKQRSELDEELRTKKEENVQMHDKINVASSEI
MALTELINNLKNELDSLQVQKSETEAELEREKQEKSELSNQITDVQKALVEQEAAYNTLE
EEHKQINELFKETEATLNKVTVDYKEAQRLLEERGKEVTSRDSTIGVHEETMESLRNELE
MKGDEIETLMEKISNIEVKLRLSNQKLRVTEQVLTEKEEAFRKEEAKHLEEQALLEKNLT
MTHETYRGMIKEIADKVNITVDGFQSMSEKLTEKQGRYEKTVMEASKILWTATNWVIERN
HEKEKMNKEIEKKDEEIKKLGGKVREDEKEKEMMKETLMGLGEEKREAIRQLCVWIDHHR
SRCEYLEEVLSKTVVARGQRRVSQRT

www.000webhost.com

Other information
Ka divergence:-0.000676133KaKs divergence:0.305011
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1668Length 2 (bp):4761Length divergence:0.481
MFE 1 (kcal):-388.84MFE 2 (kcal):-1259.91MFE divergence0.528