Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64610-AT5G42010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transducin/WD40 repeat-like superfamily protein
Function (paralog2):Transducin/WD40 repeat-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.5624403665788
Log2 mRNA fold difference:-1.2563360579866
Log2 TE fold difference:-0.33672474369967
Sequences
Protein sequence

MGTPGDEEDEDRFFDAPEVVSDDFGLHLWTSTPESVSTRRRKFLQSMGLSFKKTATDDDS
EDELEPSHTDSNVVSEVVNVSSGVKEIDLLVRNESTTSSGFDVSSVSSSDTDDQTLLARN
DASSSTSTMPGGLSESSSSKSGSFGDFHNSPFSQRDDLLKKGAKSWLKKLGVLTHVLESM
DCESVRTQLHQVARVQTHKKQFKELSSMCIDQEFSAHDGSILAMKFSPDGKYIASAGEDC
VVRVWSITEEERTDTYEVAEVDSGVYFGMNQRSQIEPLKINNEKTEKKSSFLRKSSDSTC
VVLPPTIFSISEKPLHEFKGHIGEILDLSWSEKGYLLSSSVDETVRLWRVGCDECLRTFT
HNNFVTCVAFNPVDDNYFISGSIDGKVRIWDVTRCRVVDYTDIRDIVTAVCYRPDAKGAV
IGSMTGNCRFYHIFENQLQMDQEINVHGKKKVASKRISGLQYLPSDSDSDKVMVTSADSQ
IRIICGEDVICKLKASSLRTTSASFISDGKHIISTSEDSYINVWSYSQLPSKKPYSETPK
SIRSYEGFLSHNASVAIPWLRQGRRDGLSECITDLDMKIPKVDCFSPMKGSTTWPEEKLE
DVAMSNRGKLKLLRSAWQPHLWGLVIVTATWDGRIRVFHNYGLPIRV

MGTRGNEEEEDWFSDAREEVSSVSDCNSEVADDFVQATGDLDLWTMNPESVTNRRQKFFQ
SMGFSFKKRDFDLDLDLLGDSSSDHIPVSKQLTSVSETDHEEEEKEEKLLRNESTSSGSS
VSSFSTASLAEAFSFRGSFQNRAKNIDDQILLTRDYSSNSSSIAEGLSESDSSRFDSYGD
LPNSPMSRYEESPKKGAKGWLKKLGVLTHVLDKTEECTDGESTRSSIRRQLTRVQSFKKQ
FKELSSLCVGQEFSAHDGSIVVMKFSHDGKYLASAGEDCVVRVWNIIEDERRDNEFEVAE
SDSSCVYFGMNDKSQIEPLKTENEKIEKSRGLLRKKSESTCAVLPSKVFSISETPQHEFR
GHTGEILDLSWSEKGFLLSSSVDETVRLWRVGSSDECIRVFSHKSFVTCVAFNPVDDNYF
ISGSIDGKVRIWDVSQFRVVDYTDIRQIVTALCYRPDGKGAVVGSMTGECRFYHTTDNQL
QLDRDISLHGKKKVPNKRITGFQFFPGDSDKVMVTSADSQIRIICGVDTICKLKKASSLR
TTLMSPTFASFTSDGKHIVSTIEESGIHVWDFSQPNKKASSQKPKTIRSYEGFLSRNVSV
AIPWLGQGKEDSIIADLEKSFAHFPVPLDYFSPMKGATTWPEEKLGVVAGTAAAAVSATV
SSRSKLRLLKSVCQNVHGSTPHLWGLVIVTATWDGSIRVFHNYGLPIRV

Other information
Ka divergence:-0.0649196KaKs divergence:-0.461951
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1944Length 2 (bp):2130Length divergence:0.046
MFE 1 (kcal):-612.92MFE 2 (kcal):-651.78MFE divergence0.031