Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64630-AT5G41990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):with no lysine (K) kinase 10
Function (paralog2):with no lysine (K) kinase 8

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.5983742099732
Log2 mRNA fold difference:2.6602122867955
Log2 TE fold difference:-0.99355054118969
Sequences
Protein sequence

MEEADFVQKDPTGRYIRYNDVLGRGAFKTVYKAFDEVEGIEVAWNLMSIEDVLQMPGQLD
RLYSEVHLLNSLKHDNIIKLFYSWVDDHNKSINMITELFTSGSLTLYRKKHRKVDPKAIM
NWARQILKGLHYLHSQTPPVIHRDLKCDNIFVNGNTGKVKIGDLGLAAVMQQPTARSVIG
TPEFMAPELYEEEYNELVDIYSFGMCMLEMVTCEYPYRECRNQAQIYKKVTSGIKPQSLS
KVDDPQVKQFIEKCLLPAPSRPTALELLKDQLLAVDGAKDSTLTASSNTTFKPAMPPQCE
YRPMDVEYKKNTSVSICSSAKSSQECALLQTMEVQRVAESTEFKLSGERRDDVAASMALR
IAGSSGQARKVDFDFNLKTDTARAVTGEMVEELDLSSHEVTVIAEMIDELIMKLKANRSL
PNANSVYQSKDEEAGESMKSEISADYYHRVSSNEGSRLGCCCEAVESLLSSFLDSCSMVS
NKQSEDLKTELNVIESQYNQSCQRLLRMKEEAIEKAKRKWMKLS

MASGSGFLGQISSMEEADFAEKDPSGRYIRYDDVLGRGAFKTVYKAFDEVDGIEVAWNLV
SIEDVMQMPGQLERLYSEVHLLKALKHENIIKLFYSWVDEKNKTINMITELFTSGSLRVY
RKKHRKVDPKAIKNWARQILKGLNYLHSQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLA
TVLQQPTARSVIGTPEFMAPELYEEEYNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIY
KKVTSNIKPQSLGKVDDPQVRQFIEKCLLPASSRPTALELSKDPFLARDGGKDSALLASS
STSSKYVRPPQLEHLPMDVDHNENKSVSSNEDYPWSQTIELQRIAENKEFRLRGERSDDV
TASMVLRIADPSGKCRIVHFAFYLESDTATAIAEEMVEELHLTSQEVVVIADMIDDFIMQ
LLSDRTSSHHNQNSPRLTHEDHEAANQQTVNSKDEEAAGQSMKSDISADYYFPYSANDGN
AAMEAGRDAESMSSYLDSCSMMSTIYNLSISDNDYPEDLKTELNLIESQFNQSFQDLLKL
KEDAIENAKRKWITKKQKAVNIS

Other information
Ka divergence:-0.236017KaKs divergence:0.0675768
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1575Length 2 (bp):1692Length divergence:0.036
MFE 1 (kcal):-471.42MFE 2 (kcal):-490.15MFE divergence0.019