Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64670-AT5G41900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.4753252436331
Log2 mRNA fold difference:-2.7193807913212
Log2 TE fold difference:0.21707196459549
Sequences
Protein sequence

MGFSRSLNRTVGVFVFFILDIVDFLLCFTYKTLDFFFESEWKPCYCCPPPEAKPISAGGN
RGGKMIVSERSGDYSKVVSLTRTKIYLDEISDTLYSRPSLLTKLTKLVKCFKKDVVKCCD
ESKKRSPSTKKTLLTVNSTVVEKLQRTPRWSDCHCTFCTSWLSSSNQSLFVNVQQPTDNK
AQENVVFIHGFLSSSTFWTETLFPNFSDSAKSNYRFLAVDLLGYGKSPKPNDSLYTLKEH
LEMIERSVISQFRLKTFHLVAHSLGCILALALAVKHPGAIKSLTLLAPPYYSVPKGVQGT
QYVMRRLAPKEVWPPMAFGASVASWYEHISRTVSLVLCKNHHLLEFLTRLLTRNRMRTYL
IEGFLCHTHNASWHTLHNIIFGSGSKVEAYLDHVRDNVDCEVAVFHGGRDELIPVECSYG
VKRKVPRARIHVVPDKDHITIVVGRQKEFARELELIWRRSTTPQLHSIN

MGIARWLNRTVGFFVFALLDIADFLLCYTYKTLDYFLESERKPCYCSSPPEAKAKTEKII
VSERGGYSKVVSLTRSKIHFDEISDTLYSRGPSLLTRLSKLVRSVKCFNYKGLIMRGNVV
ESCDHHESKKKISKGKKRLMTLNSTVIEKSSTAPRWSDCHCSFCTSWLTSTNRDSLFVKV
QQPKDNKKARDNVVFIHGFVSSSAFWTETLFPNFSDSAKSNYRFIAVDLLGYGRSPKPND
SLYTLREHLEMIEKSVISKFKLKTFHIVAHSLGCILALALAVKHPGAIKSLTLLAPPYYK
VPKGVQPAQYVMREVARKEVWPPMQFGASVLSWYEHLGRTIGLVLIKNHQLIEFVTRLLT
LNRMRTYLIEGFLCHTHNGSFHTLHNIIFGSGAKLDSYLDHVRDHVDCDVAIFHGGKDEL
IPVECSYSVKSKVPRATVHVIPDKDHITIVVGRQKDFARELELIWQRTKST

Other information
Ka divergence:0.154721KaKs divergence:0.278579
GC content 1 (%):49GC content 2 (%):45GC content divergence:-0.043
Length 1 (bp):1410Length 2 (bp):1416Length divergence:0.002
MFE 1 (kcal):-465.97MFE 2 (kcal):-446.92MFE divergence-0.021