Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64900-AT1G64930
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cytochrome P450, family 89, subfamily A, polypeptide 2
Function (paralog2):cytochrome P450, family 87, subfamily A, polypeptide 7

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.6574189505138
Log2 mRNA fold difference:3.27641788418
Log2 TE fold difference:-0.7276536556459
Sequences
Protein sequence

MEIWLLILASLSGSLLLHLLLRRRNSSSPPLPPDPNFLPFLGTLQWLREGLGGLESYLRS
VHHRLGPIVTLRITSRPAIFVADRSLTHEALVLNGAVYADRPPPAVISKIVDEHNISSGS
YGATWRLLRRNITSEILHPSRVRSYSHARHWVLEILFERFRNHGGEEPIVLIHHLHYAMF
ALLVLMCFGDKLDEKQIKEVEFIQRLQLLSLTKFNIFNIWPKFTKLILRKRWQEFLQIRR
QQRDVLLPLIRARRKIVEERKRSEQEDKKDYVQSYVDTLLDLELPEENRKLNEEDIMNLC
SEFLTAGTDTTATALQWIMANLVKYPEIQERLHEEIKSVVGEEAKEVEEEDVEKMPYLKA
VVLEGLRRHPPGHFLLPHSVTEDTVLGGYKVPKNGTINFMVAEIGRDPVEWEEPMAFKPE
RFMGEEEAVDLTGSRGIKMMPFGAGRRICPGIGLAMLHLEYYVANMVREFQWKEVQGHEV
DLTEKLEFTVVMKHPLKALAVPRRCH

MEIWLLILGSLSLSLLLNLLFFRLRDSSSLPLPPAPNFFPFLGTLQWLRQGLGGFNNYVR
SVHHRLGPIITLRITSRPAIFVADGSLAHQALVLNGAVFADRPPAAPISKILSNNQHTIT
SCLYGVTWRLLRRNITEILHPSRMKSYSHVRHWVLEILFDRLRKSGGEEPIVVFDHLHYA
MFAVLVLMCFGDKLDEKQIKQVEYVQRQMLLGFARYSILNLCPKFTKLILRKRWEEFFQM
RREQQDVLLRLIYARRKIVEERKKRSSEEEEENKEYVQSYVDTLLDVELPDEKRKLNEDE
IVSLCSEFLIAGSDTTATVLQWIMANLVKNQEIQERLYEEITNVVGEEAKVVEEKDTQKM
PYLKAVVMEALRRHPPGNTVLPHSVTEDTVLGGYKVPKKGTINFLVAEIGRDPKVWEEPM
AFKPERFMGEEEAVDITGSRGIKMMPFGAGRRICPGIGLAMLHLEYYVANMVREFQWKEV
EGHEVDLTEKVEFTVIMKHPLKAIAVPRRSH

www.000webhost.com

Other information
Ka divergence:0.141202KaKs divergence:-0.441911
GC content 1 (%):51GC content 2 (%):48GC content divergence:-0.03
Length 1 (bp):1521Length 2 (bp):1536Length divergence:0.005
MFE 1 (kcal):-534.15MFE 2 (kcal):-510.82MFE divergence-0.022