Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G64910-AT1G64920
Species:Arabidopsis
Duplication type:TD
Function (paralog1):UDP-Glycosyltransferase superfamily protein
Function (paralog2):UDP-Glycosyltransferase superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.0981282100156
Log2 mRNA fold difference:0.75947744387941
Log2 TE fold difference:0.27019065170845
Sequences
Protein sequence

MGQTFHAFMFPWFAFGHMTPYLHLANKLAERGHRITFLIPKKAQKQLEHLNLFPDSIVFH
SLTIPHVDGLPAGAETFSDIPMPLWKFLPPAIDLTRDQVEAAVSALSPDLILFDIASWVP
EVAKEYRVKSMLYNIISATSIAHDFVPGGELGVPPPGYPSSKLLYRKHDAHALLSFSVYY
KRFSHRLITGLMNCDFISIRTCKEIEGKFCEYLERQYHKKVFLTGPMLPEPNKGKPLEDR
WSHWLNGFEQGSVVFCALGSQVTLEKDQFQELCLGIELTGLPFFVAVTPPKGAKTIQDAL
PEGFEERVKDRGVVLGEWVQQPLLLAHPSVGCFLSHCGFGSMWESIMSDCQIVLLPFLAD
QVLNTRLMTEELKVSVEVQREETGWFSKESLSVAITSVMDQASEIGNLVRRNHSKLKEVL
VSDGLLTGYTDKFVDTLENLVSETKRE

MGQKIHAFMFPWFAFGHMTPYLHLGNKLAEKGHRVTFLLPKKAQKQLEHQNLFPHGIVFH
PLVIPHVDGLPAGAETASDIPISLVKFLSIAMDLTRDQIEAAIGALRPDLILFDLAHWVP
EMAKALKVKSMLYNVMSATSIAHDLVPGGELGVAPPGYPSSKALYREHDAHALLTFSGFY
KRFYHRFTTGLMNCDFISIRTCEEIEGKFCDYIESQYKKKVLLTGPMLPEPDKSKPLEDQ
WSHWLSGFGQGSVVFCALGSQTILEKNQFQELCLGIELTGLPFLVAVKPPKGANTIHEAL
PEGFEERVKGRGIVWGEWVQQPSWQPLILAHPSVGCFVSHCGFGSMWESLMSDCQIVFIP
VLNDQVLTTRVMTEELEVSVEVQREETGWFSKENLSGAIMSLMDQDSEIGNQVRRNHSKL
KETLASPGLLTGYTDKFVDTLENLVNEQGYIS

www.000webhost.com

Other information
Ka divergence:-0.304909KaKs divergence:0.516296
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1344Length 2 (bp):1359Length divergence:0.006
MFE 1 (kcal):-418.26MFE 2 (kcal):-407.45MFE divergence-0.013