Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G65220-AT5G36230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ARM repeat superfamily protein
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.6880009617786
Log2 mRNA fold difference:1.3362900846187
Log2 TE fold difference:0.34609079857424
Sequences
Protein sequence

MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDALVQIYLDNAGDLELVARSLESSDLNFS
RYGDIFFEVVFIGGRTQTGSVKSDEGERHPYSIIDCEPKREAILPSVVYIQKILRRKAFL
IKNLENVTRRFLQSLELFEENERKKLAIFTALAFSQKLSGLPAETVFQPLLKDTLVAKGI
VLNFVTDFFNEYLVENSLDDLISILRRGKMDDKLLEFLPPTKRTTESFAEHFTKAGLTAL
VEYNERKIFEVKLKEIKAVLTSQVTEEINVDEVTEMVKQQVKDAKLPETEVVHVIWDGIM
NAVQWSGKNQQQNSNAVLRQVKTWAPLLNTLCSTGNMEMELMYKVQMQCYEDAKLMKVFP
EVVRSLYELDVLAEDTILHWYRKGTNPKGRQTFVKGLEPFVNWLEEAEEEE

MSSKEKPTLGGTRIKTRKRNIAAPLDPAAFSDAVVQIYHDNAGDLELVAKSIESSDLNFT
RYGDIFFEVIFIGGRTQPGTVKSDEGERHTYSVIDCEPKREAILPSVVYIQKILRRKPFL
IKNLENVTRRFLQSLELFEENERKKLAIFTALAFSQKLSGLPPETVFQPLLKDNLVAKGI
VLSFVTDFFKEYLVENSLEDLISILRRGKMEDNLMDFLPPVRRSAESFAEHFTNEGLTDL
VEYHSKKMFEVKLREIKTVLTSKVTEESNVDEVIESVKQQIKDAKLPDIEVVRVVWDGLM
DAVQWSGKNQQQNANSVLRQVKTWAPLLNTFCTSGKLELELMYKVQMQCYEDAKLMKVFP
EVVRSLYELDVLAEDTILHWFRKGTNSKGRQTFVKSLEPFVNWLEEAEEEE

www.000webhost.com

Other information
Ka divergence:-0.613197KaKs divergence:-0.373596
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1236Length 2 (bp):1236Length divergence:0
MFE 1 (kcal):-372.8MFE 2 (kcal):-374.71MFE divergence0.003