Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G65710-AT5G37010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.0655934236825
Log2 mRNA fold difference:-0.011697118075806
Log2 TE fold difference:1.1259473869766
Sequences
Protein sequence

MGCCLSKKPSPSLPSSVKPSDPIKPMEPVIEPLEEEAKPKSEKLNQEEEEEEVVVIKHTR
SHEERSKKTESDKDSPVSSPVAAEKSNSTPLVRISSCTKEEVDAILIQCGKLSRSNSAAK
TRRYSGSKRSFDFDQNERIRGGDAAEEDGMQRNRHRGVERVHGSPRERRRRTPSRERERS
GSRERGNVGGGGGGSRRVSRSPAKRSEIRNADSCGSSVNSSNNRPGKFVTIPATDKSNNV
EPLVKRITVKRNIGDACRIAASPRSKSPARAGNNVPSLSRSNSRKAEQSPYRRNPLGEID
QNTKKMIESVKPNSRTSRGPSPSRVAVVELTKAPQVVLSRSRSLRKSRDFDLVSNEDNNY
TALLLKDIQSFHGKSVDDSVISLPLCVSKACSIVEAVADLNSMTNRTCLRSDSSRFRFTS
TVKKADLMEPSFEKYVTVKRGGGSLEESSGSNNVT

MGCCLSKNPPQASSSSLIDGSCSVKSPDLNKSAIDTPLKLEAQEKKIQVEESKPRNEEEK
IQEDNNSKPRKEVFVIKHRRSHEKSSKTTTDPEDSSVSDVKSTGSNHNPVDVDAILIQCG
RLSRSNSAAAKTRRYSGSKRSFDFDQNGGDADAEDGGEDEEAERRIHRQRQRGGESPRER
RRRTPSRERDDSKSNRSGSRERGSSGNGGGSRRVSRSPGRRSEINPNSSGNSVNSSNNNR
PGKFVSVPATDKALSNNNGDGSVKRITVKRNVGKAASPRSQSPARAASQPSPSKLSRKTE
HSPYRRNPLSEIDPNSVAFPLSQGDKLGSGNNIRMMNRDNENQGLVKESGTFVAQKLNPV
MNTKTVTQAPIRRTASPSRAIKEQQEAVEECKIVVSSGTELAKPQIVSRSRSLRKSRDFD
FSPEALLSNNIDINNVNSNNATAGSTFPSYTALLLEDIQNFHQKSVNVSALSSSMSKACS
IVEAVADLNSATNQHQRTEVSFTSAAAKKADLMEPSFEKYVTVKRGGSSLDDMEEQESSG
SNSFTGSSCVVQRQGYSSSSSWEPNSAESTDRVSMRSSNKQERDRSPLGVNYEKQEFDPL
KKNGVGVGRKRVAVVDSSSSGKGVLQATTTRVAAVSM

www.000webhost.com

Other information
Ka divergence:-0.172891KaKs divergence:-0.320319
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1368Length 2 (bp):1914Length divergence:0.166
MFE 1 (kcal):-412.43MFE 2 (kcal):-580.38MFE divergence0.169