Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G65790-AT1G65800
Species:Arabidopsis
Duplication type:TD
Function (paralog1):receptor kinase 1
Function (paralog2):receptor kinase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.2204762068088
Log2 mRNA fold difference:1.141850644659
Log2 TE fold difference:0.046933565784399
Sequences
Protein sequence

MRSVPNYHHSFFIFLILILFLAFSVSPNTLSATESLTISSNKTIISPSQIFELGFFNPAS
SSRWYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLKISGNNLVIFDQSDRPVWSTNITGG
DVRSPVAAELLDNGNFLLRDSNNRLLWQSFDFPTDTLLAEMKLGWDQKTGFNRILRSWKT
TDDPSSGEFSTKLETSEFPEFYICSKESILYRSGPWNGMRFSSVPGTIQVDYMVYNFTAS
KEEVTYSYRINKTNLYSRLYLNSAGLLQRLTWFETTQSWKQLWYSPKDLCDNYKVCGNFG
YCDSNSLPNCYCIKGFKPVNEQAWDLRDGSAGCMRKTRLSCDGRDGFTRLKRMKLPDTTA
TIVDREIGLKVCKERCLEDCNCTAFANADIRNGGSGCVIWTREILDMRNYAKGGQDLYVR
LAAAELEDKRIKNEKIIGSSIGVSILLLLSFVIFHFWKRKQKRSITIQTPNVDQVRSQDS
LINDVVVSRRGYTSKEKKSEYLELPLLELEALATATNNFSNDNKLGQGGFGIVYKGRLLD
GKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEYLENLSL
DSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKI
SDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRN
KGFYNSNRDLNLLGFVWRHWKEGNELEIVDPINIDSLSSKFPTHEILRCIQIGLLCVQER
AEDRPVMSSVMVMLGSETTAIPQPKRPGFCIGRSPLEADSSSSTQRDDECTVNQITLSVI
DAR

MRNVPNYHHSYFILFIIILFLAFSVYASNFSATESLTISSNKTIISPSQIFELGFFNPDS
SSRWYLGIWYKIIPIRTYVWVANRDNPLSSSNGTLKISDNNLVIFDQSDRPVWSTNITGG
DVRSPVAAELLDYGNFVLRDSKNNKPSGFLWQSFDFPTDTLLSDMKMGWDNKSGGFNRIL
RSWKTTDDPSSGDFSTKLRTSGFPEFYIYNKESITYRSGPWLGNRFSSVPGMKPVDYIDN
SFTENNQQVVYSYRVNKTNIYSILSLSSTGLLQRLTWMEAAQSWKQLWYSPKDLCDNYKE
CGNYGYCDANTSPICNCIKGFEPMNEQAALRDDSVGCVRKTKLSCDGRDGFVRLKKMRLP
DTTETSVDKGIGLKECEERCLKGCNCTAFANTDIRNGGSGCVIWSGGLFDIRNYAKGGQD
LYVRVAAGDLEDKRIKSKKIIGSSIGVSILLLLSFIIFHFWKRKQKRSITIQTPIVDLVR
SQDSLMNELVKASRSYTSKENKTDYLELPLMEWKALAMATNNFSTDNKLGQGGFGIVYKG
MLLDGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHINLVRLLGCCVDKGEKMLIYEYLE
NLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNM
TPKISDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIIS
GKRNKGFYNSNRDLNLLGFVWRHWKEGKELEIVDPINIDALSSEFPTHEILRCIQIGLLC
VQERAEDRPVMSSVMVMLGSETTAIPQPKRPGFCVGRSSLEVDSSSSTQRDDECTVNQVT
LSVIDAR

Other information
Ka divergence:0.0639005KaKs divergence:0.390991
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):2532Length 2 (bp):2544Length divergence:0.002
MFE 1 (kcal):-739.39MFE 2 (kcal):-714.74MFE divergence-0.017