Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G65880-AT1G65890
Species:Arabidopsis
Duplication type:TD
Function (paralog1):benzoyloxyglucosinolate 1
Function (paralog2):acyl activating enzyme 12

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.6714435874879
Log2 mRNA fold difference:1.1418775355322
Log2 TE fold difference:1.4623704577152
Sequences
Protein sequence

MDDLALCEANNVPLTPMTFLKRASECYPNRTSIIYGKTRFTWPQTYDRCCRLAASLISLN
ISKNDVVSVMAPNTPALYEMHFAVPMAGAVLNPINTRLDATSIAAILRHAKPKILFLDRS
FEALARESLHLLSSEDSNLNLPVIFIHENDFPKRASFEELDYECLIQRGEPTPSMVARMF
RIQDEHDPISLNYTSGTTADPKGVVISHRGAYLCTLSAIIGWEMGTCPVYLWTLPMFHCN
GWTFTWGTAARGGTSVCMRHVTAPEIYKNIEMHNVTHMCCVPTVFNILLKGNSLDLSPRS
GPVHVLTGGSPPPAALVKKVQRLGFQVMHAYGQTEATGPILFCEWQDEWNRLPENQQMEL
KARQGISILGLADVDVKNKETQKSAPRDGKTMGEILIKGSSIMKGYLKNPKATFEAFKHG
WLNTGDVGVIHPDGHVEIKDRSKDIIISGGENISSVEVENVLYKYPKVLETAVVAMPHPT
WGETPCAFVVLEKSETTIKEDRVDKFQTRERNLIEYCRENLPHFMCPRKVVFLEELPKNG
NGKILKPKLRDIAKGLVVEDEINVIAKEVKRPVGHFISRL

MDNLALCEANNVPLTPITFLKRASECYPNRTSIIYGKTRFTWPQTYDRCCRLAASLISLN
IGKNDVVSVVAPNTPAMYEMHFAVPMAGAVLNPINTRLDATSIAAILRHAKPKILFIYRS
FEPLAREILQLLSSEDSNLNLPVIFIHEIDFPKRVSSEESDYECLIQRGEPTPLLLARMF
CIQDEHDPISLNYTSGTTADPKGVVISHRGAYLSTLSAIIGWEMGTCPVYLWTLPMFHCN
GWTFTWGTAARGGTSVCMRHVTAPEIYKNIEMHNVTHMCCVPTVFNILLKGNSLDLSHRS
GPVHVLTGGSPPPAALVKKVQRLGFQVMHAYGLTEATGPVLFCEWQDEWNRLPENQQMEL
KARQGLSILGLTEVDVRNKETQESVPRDGKTMGEIVMKGSSIMKGYLKNPKATYEAFKHG
WLNSGDVGVIHPDGHVEIKDRSKDIIISGGENISSVEVENIIYKYPKVLETAVVAMPHPT
WGETPCAFVVLEKGETNNEDREDKLVTKERDLIEYCRENLPHFMCPRKVVFLDELPKNGN
GKILKPKLRDIAKGLVAEDEVNVRSKVQRPVEHFTSRL

www.000webhost.com

Other information
Ka divergence:-0.0384747KaKs divergence:-0.95423
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1743Length 2 (bp):1737Length divergence:-0.002
MFE 1 (kcal):-511.28MFE 2 (kcal):-527.4MFE divergence0.016