Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G65970-AT1G65980
Species:Arabidopsis
Duplication type:TD
Function (paralog1):thioredoxin-dependent peroxidase 2
Function (paralog2):thioredoxin-dependent peroxidase 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.5966238210764
Log2 mRNA fold difference:-0.76693538923168
Log2 TE fold difference:2.3252355477055
Sequences
Protein sequence

MAPITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFI
GKAEELKSKGIDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKD
KGLGIRSRRFALLLDNLKVTVANVESGGEFTVSSAEDILKAL

MAPIAVGDVVPDGTISFFDENDQLQTASVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFI
EKAEELKSKGVDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKD
KGLGVRSRRFALLLDDLKVTVANVESGGEFTVSSADDILKAL

Other information
Ka divergence:-0.73532KaKs divergence:-0.863175
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):489Length 2 (bp):489Length divergence:0
MFE 1 (kcal):-158.6MFE 2 (kcal):-148.86MFE divergence-0.032