Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G66040-AT1G66050
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Zinc finger (C3HC4-type RING finger) family protein
Function (paralog2):Zinc finger (C3HC4-type RING finger) family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.048137677295342
Log2 mRNA fold difference:-0.20726737948264
Log2 TE fold difference:0.19580394239612
Sequences
Protein sequence

MAIQTQLPCDGDGVCMRCQVTPPSEETLTCGTCVTPWHVSCLLPESLASSTGDWECPDCS
GVVVPSAAPGTGISGPESSGSVLVAAIRAIQADVTLTEAEKAKKRQRLMSGGGDDGVDDE
EKKKLEIFCSICIQLPERPVTTPCGHNFCLKCFEKWAVGQGKLTCMICRSKIPRHVAKNP
RINLALVSAIRLANVTKCSGEATAAKVHHIIRNQDRPDKAFTTERAVKTGKANAASGKFF
VTIPRDHFGPIPAANDVTRNQGVLVGESWEDRQECRQWGVHFPHVAGIAGQAAVGAQSVA
LSGGYDDDEDHGEWFLYTGSGGRDLSGNKRVNKIQSSDQAFKNMNEALRLSCKMGYPVRV
VRSWKEKRSAYAPAEGVRYDGVYRIEKCWSNVGVQGLHKMCRYLFVRCDNEPAPWTSDEH
GDRPRPLPDVPELENATDLFVRKESPSWGFDEAEGRWKWMKSPPVSRMALDTEERKKNKR
AKKGNNAMKARLLKEFSCQICRKVLSLPVTTPCAHNFCKACLEAKFAGITQLRDRSNGVR
KLRAKKNIMTCPCCTTDLSEFLQNPQVNREMMEIIENFKKSEEEAEVAESSNISEEEEEE
SEPPTKKIKMDNNSVGDTSLSA

MAIQTQLPCDGDGVCMRCQVNPPSEETLTCGTCVTPWHVSCLLPESLASSTGDWECPDCS
GVVVPSAAPGTGISGPESSGSVLVTAIRAIQADVTLTEAEKAKKRQRLMSGGGDDGVDDE
EKKKLEIFCSICIQLPERPVTTPCGHNFCLKCFEKWAVGQGKLTCMICRSKIPRHVAKNP
RINLALVSAIRLANVTKCSGEATAAKVHHIIRNQDRPDKAFTTERAVKTGKANAASGKFF
VTIPRDHFGPIPAANDVTRNQGVLVGESWEDRQECRQWGVHFPHVAGIAGQAAVGAQSVA
LSGGYDDDEDHGEWFLYTGSGGRDLSGNKRVNKIQSSDQAFKNMNEALRLSCKMGYPVRV
VRSWKEKRSAYAPAEGVRYDGVYRIEKCWSNVGVQGLHKMCRYLFVRCDNEPAPWTSDEH
GDRPRPLPDVPELENATDLFVRKESPSWGFDEAEGRWKWMKSPPVSRMALDTEERKKNKR
AKKGNNAMKARLLKEFSCQICRKVLSLPVTTPCAHNFCKACLEAKFAGITQLRDRSNGVR
KLRAKKNIMTCPCCTTDLSEFLQNPQVNREMMEIIENFKKSEEEAEVAESSNISEEEGEE
ESEPPTKKIKMDKNSVGGTSLSA

Other information
Ka divergence:1KaKs divergence:1
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1869Length 2 (bp):1872Length divergence:0.001
MFE 1 (kcal):-614.67MFE 2 (kcal):-611.2MFE divergence-0.003