Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G66160-AT5G37490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CYS, MET, PRO, and GLY protein 1
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.4431123626083
Log2 mRNA fold difference:-1.4349004588824
Log2 TE fold difference:-1.4603219552711
Sequences
Protein sequence

MGLSLRVRRRGGSVSKKEIIPVTSCSEEVEITIPSQFQCPISYELMKDPVIIASGITYDR
ENIEKWFESGYQTCPVTNTVLTSLEQIPNHTIRRMIQGWCGSSLGGGIERIPTPRVPVTS
HQVSEICERLSAATRRGDYAACMEMVTKMTRLGKESERNRKCVKENGAGLVLCVCFDAFS
ENANASLLLEETVSVLTWMLPIGLEGQSKLTTTSSFNRLVELLRNGDQNAAFLIKELLEL
NVTHVHALTKINGVQEAFMKSINRDSTCVNSLISIHHMILTNQETVSRFLELDLVNITVE
MLVDSENSVCEKALTVLNVICETKEGREKVRRNKLVIPILVKKILKISEKKDLVSVMWKV
CKSGDGSEVEEALRLGAFKKLVVMLQVGCGEGTKEKVTELLKMMNKVMKMNGFVDRSYSS
SIEFKHVKKPF

MGFLWRTRSNEKKITPVLSWPESEPESEITIPPEFQCPISIDLMKDPVIISTGITYDRVS
IETWINSGNKTCPVTNTVLTTFDQIPNHTIRKMIQGWCVEKGSPLIQRIPTPRVPLMPCE
VYEISRKLSSATRRGDYEKCGVIIEKIKKLGDESEKNRKCVNENSVGWVLCDCFDKFSGD
EKLTFMLNEILSLLTWMFPIGLEGISKLASATSFRCVAGLLKSTDDSVRQNAAFIMKEIL
SLDETRVHSFAVENGVAEALVKLIRDSVSSSSTKSSLIAIYQMVLQKPEIASEFLEIGLV
SITVEMIVDAENSVCEKALAVLDAICETEHGREEVRKNALVMPLLVKKIAKVSELATRSS
MSMILKLWKTGNTVAVEDAVRLGAFQKVLLVLQVGYGEETKEKATELLKMMNTQMKLMSD
CVDSLKEFKYIKKPF

www.000webhost.com

Other information
Ka divergence:-0.013611KaKs divergence:-0.871102
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1296Length 2 (bp):1308Length divergence:0.005
MFE 1 (kcal):-413.8MFE 2 (kcal):-381.9MFE divergence-0.04