Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G66180-AT5G37540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Eukaryotic aspartyl protease family protein
Function (paralog2):Eukaryotic aspartyl protease family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.9539444630744
Log2 mRNA fold difference:-3.3062017364648
Log2 TE fold difference:-0.7051391185156
Sequences
Protein sequence

MSPIPKPLFFFFFLNYVSLSTSLSLHLPLTSLPISTTTNSHRFTTSLLSRKNPSPSSPPY
NFRSRFKYSMALIISLPIGTPPQAQQMVLDTGSQLSWIQCHRKKLPPKPKTSFDPSLSSS
FSTLPCSHPLCKPRIPDFTLPTSCDSNRLCHYSYFYADGTFAEGNLVKEKITFSNTEITP
PLILGCATESSDDRGILGMNRGRLSFVSQAKISKFSYCIPPKSNRPGFTPTGSFYLGDNP
NSHGFKYVSLLTFPESQRMPNLDPLAYTVPMIGIRFGLKKLNISGSVFRPDAGGSGQTMV
DSGSEFTHLVDAAYDKVRAEIMTRVGRRLKKGYVYGGTADMCFDGNVAMIPRLIGDLVFV
FTRGVEILVPKERVLVNVGGGIHCVGIGRSSMLGAASNIIGNVHQQNLWVEFDVTNRRVG
FAKADCSRVV

MSTISKPLFLKLLYIFFFFCYSVSLSWSSSLSLHFPLTSLRLTPTTNSSSFKTSLLSRRN
PSPPSSPYTFRSNIKYSMALILSLPIGTPSQSQELVLDTGSQLSWIQCHPKKIKKPLPPP
TTSFDPSLSSSFSDLPCSHPLCKPRIPDFTLPTSCDSNRLCHYSYFYADGTFAEGNLVKE
KFTFSNSQTTPPLILGCAKESTDEKGILGMNLGRLSFISQAKISKFSYCIPTRSNRPGLA
STGSFYLGDNPNSRGFKYVSLLTFPQSQRMPNLDPLAYTVPLQGIRIGQKRLNIPGSVFR
PDAGGSGQTMVDSGSEFTHLVDVAYDKVKEEIVRLVGSRLKKGYVYGSTADMCFDGNHSM
EIGRLIGDLVFEFGRGVEILVEKQSLLVNVGGGIHCVGIGRSSMLGAASNIIGNVHQQNL
WVEFDVTNRRVGFSKAECRLLP

Other information
Ka divergence:0.0632469KaKs divergence:0.405551
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1293Length 2 (bp):1329Length divergence:0.014
MFE 1 (kcal):-354.14MFE 2 (kcal):-364.91MFE divergence0.015