Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G66200-AT5G37600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glutamine synthase clone F11
Function (paralog2):glutamine synthase clone R1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.3071137865135
Log2 mRNA fold difference:-2.4589014300812
Log2 TE fold difference:1.1245082196769
Sequences
Protein sequence

MSLLADLVNLDISDNSEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSST
GQAPGQDSEVILYPQAIFKDPFRRGNNILINVFYRFDQVMCDAYTPAGEPIPTNKRHAAA
EIFANPDVIAEVPWYGIEQEYTLLQKDVNWPLGWPIGGFPGPQGPYYCSIGADKSFGRDI
VDAHYKASLYAGINISGINGEVMPGQWEFQVGPSVGISAADEIWIARYILERITEIAGVV
VSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIEKLGLRHKEHISAYGEGNERR
LTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETT
LLWNP

MSLVSDLINLNLSDSTDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSST
GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSNPDVA
AEVPWYGIEQEYTLLQKDVKWPVGWPIGGYPGPQGPYYCGIGADKSFGRDVVDSHYKACL
YAGINISGINGEVMPGQWEFQVGPAVGISAADEIWVARYILERITEIAGVVVSFDPKPIP
GDWNGAGAHCNYSTKSMREEGGYEIIKKAIDKLGLRHKEHIAAYGEGNERRLTGHHETAD
INTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIAETTILWNP

Other information
Ka divergence:-0.179328KaKs divergence:-0.890746
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):1098Length 2 (bp):1071Length divergence:-0.012
MFE 1 (kcal):-345.39MFE 2 (kcal):-351.06MFE divergence0.008