Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G66260-AT5G37720
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA-binding (RRM/RBD/RNP motifs) family protein
Function (paralog2):ALWAYS EARLY 4

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.7100713362625
Log2 mRNA fold difference:-0.93095482008319
Log2 TE fold difference:-0.78218553286328
Sequences
Protein sequence

MSDALNMTLDEIVKKSKSERSAAARSGGKGVSRKSGRGRGGPNGVVGGGRGGGPVRRGPL
AVNTRPSSSFSINKLARRKRSLPWQNQNDLYEETLRAVGVSGVEVGTTVYITNLDQGVTN
EDIRELYAEIGELKRYAIHYDKNGRPSGSAEVVYMRRSDAIQAMRKYNNVLLDGRPMKLE
ILGGNTESAPVAARVNVTGLNGRMKRSVFIGQGVRGGRVGRGRGSGPSGRRLPLQQNQQG
GVTAGRGGFRGRGRGNGGGRGNKSGGRGGKKPVEKSAADLDKDLESYHAEAMNIS

MSGALNMTLDEIVKRGKTARSGGRGISRGRGRGRGGGGRGAGPARRGPLAVNARPSSFTI
NKPVRRVRSLPWQSGLFEDGLRAAGASGVEVGTRLHVTNLDQGVTNEDIRELFSEIGEVE
RYAIHYDKNGRPSGTAEVVYPRRSDAFQALKKYNNVLLDGRPMRLEILGGNNSSEAPLSG
RVNVNVTGLNGRLKRTVVIQQGGGGRGRVRGGRGGRGPAPTVSRRLPIHNQQGGGMRGGR
GGFRARGRGNGGRGRGGGRGNGKKPVEKSAADLDKDLESYHADAMNTS

Other information
Ka divergence:0.0997369KaKs divergence:-0.150062
GC content 1 (%):46GC content 2 (%):49GC content divergence:0.032
Length 1 (bp):888Length 2 (bp):867Length divergence:-0.012
MFE 1 (kcal):-268.76MFE 2 (kcal):-288.09MFE divergence0.035