Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G66400-AT5G37770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):calmodulin like 23
Function (paralog2):EF hand calcium-binding protein family

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.9650167865144
Log2 mRNA fold difference:2.7021737971208
Log2 TE fold difference:-0.77542898351551
Sequences
Protein sequence

MSKNVSRNCLGSMEDIKKVFQRFDKNNDGKISIDELKDVIGALSPNASQEETKAMMKEFD
LDGNGFIDLDEFVALFQISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGE
KCSIQDCQRMINKVDSDGDGCVDFEEFKKMMMINGSA

MSSKNGVVRSCLGSMDDIKKVFQRFDKNGDGKISVDELKEVIRALSPTASPEETVTMMKQ
FDLDGNGFIDLDEFVALFQIGIGGGGNNRNDVSDLKEAFELYDLDGNGRISAKELHSVMK
NLGEKCSVQDCKKMISKVDIDGDGCVNFDEFKKMMSNGGGA

Other information
Ka divergence:-0.327011KaKs divergence:-0.405483
GC content 1 (%):36GC content 2 (%):42GC content divergence:0.077
Length 1 (bp):474Length 2 (bp):486Length divergence:0.013
MFE 1 (kcal):-114.9MFE 2 (kcal):-128.5MFE divergence0.056