Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G66740-AT5G38110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ASF1 like histone chaperone
Function (paralog2):anti- silencing function 1b

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.1405812655498
Log2 mRNA fold difference:-1.7081971470557
Log2 TE fold difference:-0.41498995056672
Sequences
Protein sequence

MSAIKITNVAVLHNPAPFVSPFQFEISYECLNSLKDDLEWKLIYVGSAEDETYDQLLESV
LVGPVNVGNYRFVFQADPPDPSKIQEEDIIGVTVLLLTCSYMGQEFLRVGYYVNNDYEDE
QLKEEPPTKVLIDKVQRNILSDKPRVTKFPIDFHPEEEQTAATAAPPEQSDEQQPNVNGE
AQVLPDQSVEPKPEES

MSSINITNVTVLDNPAPFVNPFQFEISYECLTSLKDDLEWKLIYVGSAEDETYDQVLESV
LVGPVNVGNYRFVLQADSPDPLKIREEDIIGVTVLLLTCSYMDQEFIRVGYYVNNDYDDE
QLREEPPTKVLIDKVQRNILTDKPRVTKFPINFHPENEQTLGDGPAPTEPFADSVVNGEA
PVFLEQPQKLQEIEQFDDSDVNGEAIALLDQPQNLQET

www.000webhost.com

Other information
Ka divergence:-0.103041KaKs divergence:-0.226534
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):591Length 2 (bp):657Length divergence:0.053
MFE 1 (kcal):-152.2MFE 2 (kcal):-175MFE divergence0.07