Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G66840-AT5G38150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein of unknown function (DUF827)
Function (paralog2):Plant protein of unknown function (DUF827)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.57884565465108
Log2 mRNA fold difference:-0.6480949529734
Log2 TE fold difference:0.017276421861579
Sequences
Protein sequence

MGERNLDGTVSVKATINKYGQKATRSVIKSSVAEDLHKSGRELGIYRESRRVAESAKAKA
EVELCKAKKIVKELTLRIEESNRRLKSRRIDIEAVMNESRIDGNGGYVRIMRELEDMKQE
LSKLKLDVVYVSREKVVAEKEVMELESRMEENLKLLESLKLEVDVANEEHVLVEVAKIEA
LKECKEVEEQREKERKEVSESLHKRKKRIREMIREIERSKNFENELAETLLDIEMLETQL
KLVKEMERKVQRNESMSRSKNRAFERGKDNLSVLKEVTEATEAKKAELASINAELFCLVN
TMDTLRKEFDHAKKETAWLDKMIQKDDVMLERLNTKLLIAKDQLEAVSKAEERISYLADN
LTTSFEKLKSDREAAKKEELKLREEARIINNEIQKTETGFDGKEKELLSKLDELEKAKHA
ESLALEKLETMVEKTMETREMESRRNSTITISRFEYEYLSGKACHAEETAEKKVEAAMAW
VEALKASTKAIMIKTESLKRVSGKTMLEEERESFRMQRSLSIKRLVQDEIQKFKGNSEDN
GLINSPKPVRKSVRLSGKFAPVQGGKSRRYSSGNRATPTFFVIKKKKKVPNMVKFFSRKR
RNSSLEQ

MLNRAMENSDMKRNSSTLLDLPVVKSSLVVEAIHMSRKKLGWYNESRRDSETVKARVEAG
LSEVKKSVEELALLIKRSNRSAGFQEKDMEVLKMEEKYAEVMRVLEVVKEEVSRVKLDVS
SVLIERVAAEEKVEELRFKTEGGLRLLESLKKEIEVANEEHLMVALGKIEALKGYKEIER
QREGKAIKVLDLLVERNKRIKNMLEEAERSKDIEIELFETSTDVEMLETQLKLFKKMERR
VQGRDSSSMSRSNRSFGRGKYSLSVLKEVTEGKKEELASVKVEIFRVMTVMDALRNEIIR
ARDETACLGKILREDDVKIEKLNSKILIEKSKLEVVSIAEERISSLAENFVGSLEKIKKS
RNAAKKEEFLFKEEKTVTKAETQKTKLDIDKKESELNSKLDELEKVKHTEALVLEKLESL
VEDMMESREMESEHCSTITISRFEYEYLSKHASQAEETAEKKVAAAAAWVEALKASTKSF
LMKTETLMRESEMTKAEEEREVFRMERSLSTKRLVEGEIQKIKRNSEAEGYISPKPVGKF
TPVQRGKPRRYSSVGTPTFFVIKKKKKVPRLAKFFSRRS

www.000webhost.com

Other information
Ka divergence:0.0805008KaKs divergence:-0.00835771
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):1824Length 2 (bp):1740Length divergence:-0.024
MFE 1 (kcal):-462.48MFE 2 (kcal):-434.34MFE divergence-0.031