Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G66880-AT5G38210
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.074418877052598
Log2 mRNA fold difference:0.85650509357488
Log2 TE fold difference:-0.96741654301851
Sequences
Protein sequence

MKNMNFERLSELMAFYHLMGKISSECGNITAGFPFWGGNRLKHCGLPSLELHCSKNITSL
FISSQEFYVLHLNQTSKTLKLARTDLLGSICNSTFTTITLPPNIFELSPTYKRLTVFYYC
FLLTHYVSSYKCPMRGFIFVSENHEYHKICGDTFTVIVPTRFGAGEKELNMTNLESVLSK
GFEVKVKIDDTSCQECLSSHGSCGFNETLPVGGKCSPLNPTTQPPPQPGDRHKHCGHPLL
ELRCDQNKSTSLFISDQEFFVLHVDQTSYSLTLARPDLLHSFCSLTFTNTTLPPEIFELS
PAYKSVTFYHCYPVLPDLSNYTCPVIGPISVSGNPEDHETCFPNFAANVPTSFVTKEKKL
NIANLESVLEKGFEVNMNVIMKACQACSYSNESCGFDENFPFEVKCKPHHSPTAKFQCGN
ITAGFPFSGGNRPQICGHPSLELHCYNNMASIIISDHFYNVLHIDQTSNTLRLARAELEG
SFCNATYTATTLPSKIFEISSTYKSLTVFYLCDPKVSYRSSYTCPGRGLVSVSQNSDYHN
SCQDSFTINVPKSFVPEEKELDVTNLESALREGFEVKVKVDEKTCQKCTSSGGTCGFQNS
TQICCKEASSLGCNKVHPLPDATELELHRRCNGTFSCGDQRELFYPFWTSGREDCGHPDF
KLDDCSGRFAELSISSVKFRILASVYGSNIIRLGRSEYIGDLCPQDPINAPFSESVLPFA
PNTELLTIFYNCSRDFPQQVTNFGDFACGDDSDDDRSYYVTRNLSFPPLSEINDLLYDFS
QSCDRNVSIPASGSTLNILQSTPSNDNLKKALEYGFELELNQDCRTCIDSKGACGYSQTS
SRFVCYSIEEPQTPTPPNPTRNKDTSLSIGAKAGIAVASVSGLAILLLAGLFLCIRRRRK
TQDAQYTSKSLPITSYSSRDTSRNPTSTTISSSSNHSLLPSISNLANRSDYCGVQVFSYE
ELEEATENFSRELGDGGFGTVYYGVLKDGRAVAVKRLYERSLKRVEQFKNEIEILKSLKH
PNLVILYGCTSRHSRELLLVYEYISNGTLAEHLHGNRAEARPLCWSTRLNIAIETASALS
FLHIKGIIHRDIKTTNILLDDNYQVKVADFGLSRLFPMDQTHISTAPQGTPGYVDPEYYQ
CYQLNEKSDVYSFGVVLTELISSKEAVDITRHRHDINLANMAVSKIQNNALHELVDSSLG
YDNDPEVRRKMMAVAELAFRCLQQERDVRPAMDEIVEILRGIKDDEKKRVLVKSPDVVDI
ECGGGDDVGLLRNSVPPPISPETDKWTSSSDTAASL

MFSPVLFRFSKPNSFLVLLFFLSYIHFLPCAQSQREPCDTLFRCGDLTAGFPFWGVARPQ
PCGHPSLGLHCQKQTNSTSLIISSLMYRVLEVNTTTSTLKLVRQDFSGPFCSASFSGATL
TPELFELLPDYKTLSAYYLCNPSLHYPAKFICPNKGVGSIHQDDLYHNHCGGIFNITVPI
GYAPEEGALNVTNLESVLKKGFEVKLSIDERPCQECKTNGGICAYHVATPVCCKTNSSSE
VNCTPMMPSGSSAHAGLSKKGKIGIGFASGFLGATLIGGCLLCIFIRRRKKLATQYTNKG
LSTTTPYSSNYTMSNTPTSTTISGSNHSLVPSISNLGNGSVYSGIQVFSYEELEEATENF
SKELGDGGFGTVYYGTLKDGRAVAVKRLFERSLKRVEQFKNEIDILKSLKHPNLVILYGC
TTRHSRELLLVYEYISNGTLAEHLHGNQAQSRPICWPARLQIAIETASALSYLHASGIIH
RDVKTTNILLDSNYQVKVADFGLSRLFPMDQTHISTAPQGTPGYVDPEYYQCYRLNEKSD
VYSFGVVLSELISSKEAVDITRHRHDINLANMAISKIQNDAVHELADLSLGFARDPSVKK
MMSSVAELAFRCLQQERDVRPSMDEIVEVLRVIQKDGISDSKDVVVEIDVNGGDDVGLLK
HGVPPPLSPETDKTTASSSNTTASSF

Other information
Ka divergence:-0.106254KaKs divergence:0.2344
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):3891Length 2 (bp):2061Length divergence:-0.307
MFE 1 (kcal):-1102.26MFE 2 (kcal):-577.28MFE divergence-0.313