Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G66900-AT5G38220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.79795764435581
Log2 mRNA fold difference:-0.68111354055727
Log2 TE fold difference:-0.14151478572928
Sequences
Protein sequence

MGGVTSSIAAKFAFFPPTPPSYEVIADDSCGGRLYIPEIPRRDDVDILKLRTRCGNEIVA
VYVKHSKANGTLLYSHGNAADLGQMFELFVELSNRLRVNLMGYDYSGYGQSTGQASECNT
YADIEASYKCLKEKYGVKDDQLIVYGQSVGSGPTVDLASRTPNLRGVVLQCPILSGMRVL
YPVKCTYWFDIYKNIDKIGSVTCPVLVIHGTADEVVDWSHGKRLWELSKEKYEPLWISGG
GHCDLELYPDFIRHLKKFVVSLGNKQAEQAPT

MGGVTSSIAAKFAFFPPSPPSYGFVSDVDRLYITEVPRRDDVDVLKLKTRRGNEIVAIYI
KHPKANGTLLYSHGNAADLGQMFELFIELSNRLRLNLMGYDYSGYGQSTGKASECNTYAD
IDAAYTCLKEHYGVKDDQLILYGQSVGSGPTIDLASRTPNLRGVVLHSPILSGMRVLYPV
KRTYWFDIYKNIDKIGAVTCPVLVIHGTADEVVDCSHGKQLWELSKEKYEPLWVSGGGHC
NLELYPEFIKHLKKYVISISKGPRTGSNKTATTDAAKKQSKPAENGRADTFQLGCCLPEV
SRNSVDSQLEKSKKTSKPEKSRMSIDRFRRKKGSVW

Other information
Ka divergence:-0.169801KaKs divergence:-0.50221
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):819Length 2 (bp):1011Length divergence:0.105
MFE 1 (kcal):-250.6MFE 2 (kcal):-289.9MFE divergence0.073