Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G67035-AT5G38300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.532300357418
Log2 mRNA fold difference:0.96231245465679
Log2 TE fold difference:0.31871748420165
Sequences
Protein sequence

MKDTISNPSLESLLFPVNPMSDTQQKLKLLVDNGDYGFERGSRYGEYARLRESKLRMKRD
FEKILKEEQVRFGFTREEEIRVLPEKKTRFGFNPNQRKTSSSSSSSLAQSVPDFSSMIRK
ENRRPPVNSNLLPRRTELTPPSMKSRNAAVFAGSVIRGSVSASAGEKKGIGMMRKSYAAV
DDLKKISMAAASAINGGGGKRRSIGGGGGRKSLGGGGGGRTILGYRQIY

MADIISNPTMEQLFFSVDPMSLILSQNSDTHQLKLLLDGFSGFERGPRYDEYSRLRESKL
RMKRDFQKFLEEEDEVEEPRIKKQVRFEGNSVNSQEGDKFSPEKKKQSRFEGISVISQED
RFSPEKVKKQSRFGFSPLKKAVPSSLAQSVPDFSAVIRKENRRPVNINTITPPPPTSKSR
NGGVLTGSASRGSKSASAGEKKSKGMMMMGMARKSYANVEDLKKISMAAASAINGGGGGG
GGGRKVGDCGGGRRTILGYRQIY

www.000webhost.com

Other information
Ka divergence:-0.184313KaKs divergence:0.0536723
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):690Length 2 (bp):792Length divergence:0.069
MFE 1 (kcal):-212.01MFE 2 (kcal):-238.02MFE divergence0.058