Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G67090-AT5G38430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ribulose bisphosphate carboxylase small chain 1A
Function (paralog2):Ribulose bisphosphate carboxylase (small chain) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.5514667211195
Log2 mRNA fold difference:-0.8877767010051
Log2 TE fold difference:-0.68872591320415
Sequences
Protein sequence

MASSMLSSATMVASPAQATMVAPFNGLKSSAAFPATRKANNDITSITSNGGRVNCMQVWP
PIGKKKFETLSYLPDLTDSELAKEVDYLIRNKWIPCVEFELEHGFVYREHGNSPGYYDGR
YWTMWKLPLFGCTDSAQVLKEVEECKKEYPNAFIRIIGFDNTRQVQCISFIAYKPPSFTG

MASSMLSSAAVVTSPAQATMVAPFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWP
PIGKKKFETLSYLPDLTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGR
YWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTD
A

Other information
Ka divergence:0.0165963KaKs divergence:-0.269436
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):543Length 2 (bp):546Length divergence:0.003
MFE 1 (kcal):-170.46MFE 2 (kcal):-161.02MFE divergence-0.028