Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G67110-AT5G38450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cytochrome P450, family 735, subfamily A, polypeptide 2
Function (paralog2):cytochrome P450, family 735, subfamily A, polypeptide 1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.0609223287714
Log2 mRNA fold difference:-2.6896367124012
Log2 TE fold difference:0.63315713762089
Sequences
Protein sequence

MMVTLVLKYVLVIVMTLILRVLYDSICCYFLTPRRIKKFMERQGITGPKPRLLTGNIIDI
SKMLSHSASNDCSSIHHNIVPRLLPHYVSWSKQYGKRFIMWNGTEPRLCLTETEMIKELL
TKHNPVTGKSWLQQQGTKGFIGRGLLMANGEAWHHQRHMAAPAFTRDRLKGYAKHMVECT
KMMAERLRKEVGEEVEIGEEMRRLTADIISRTEFGSSCDKGKELFSLLTVLQRLCAQATR
HLCFPGSRFLPSKYNREIKSLKTEVERLLMEIIDSRKDSVEIGRSSSYGDDLLGLLLNQM
DSNKNNLNVQMIMDECKTFFFTGHETTSLLLTWTLMLLAHNPTWQDNVRDEVRQVCGQDG
VPSVEQLSSLTSLNKVINESLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHH
SNELWGEDANEFNPERFTTRSFASSRHFMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFS
FAISENYRHAPIVVLTIKPKYGVQLVLKPLDL

MLLTILKSLLVIFVTTILRVLYDTISCYWLTPRRIKKIMEQQGVTGPKPRPLTGNILEIS
AMVSQSASKDCDSIHHDIVGRLLPHYVAWSKQYGKRFIVWNGTDPRLCLTETELIKELLM
KHNGVSGRSWLQQQGTKNFIGRGLLMANGQDWHHQRHLAAPAFTGERLKGYARHMVECTS
KLVERLRKEVGEGANEVEIGEEMHKLTADIISRTKFGSSFEKGKELFNHLTVLQRRCAQA
TRHLCFPGSRFLPSKYNREIKSLKKEVERLLIEIIQSRRDCAEMGRSSTHGDDLLGLLLN
EMDIDKNNNNNNNNLQLIMDECKTFFFAGHETTALLLTWTTMLLADNPTWQEKVREEVRE
VFGRNGLPSVDQLSKLTSLSKVINESLRLYPPATLLPRMAFEDLKLGDLTIPKGLSIWIP
VLAIHHSEELWGKDANQFNPERFGGRPFASGRHFIPFAAGPRNCIGQQFALMEAKIILAT
LISKFNFTISKNYRHAPIVVLTIKPKYGVQVILKPLVS

www.000webhost.com

Other information
Ka divergence:0.0576804KaKs divergence:-0.130864
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1539Length 2 (bp):1557Length divergence:0.006
MFE 1 (kcal):-457.11MFE 2 (kcal):-479.9MFE divergence0.024