Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G67210-AT5G38600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Proline-rich spliceosome-associated (PSP) family protein / zinc knuckle (CCHC-type) family protein
Function (paralog2):Proline-rich spliceosome-associated (PSP) family protein / zinc knuckle (CCHC-type) family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.5358278483653
Log2 mRNA fold difference:1.7384551580695
Log2 TE fold difference:-0.44207838793554
Sequences
Protein sequence

MAASSGSGLEAEEGEISIDMEEDMDLTEDDFRNVSGQFSGQASIVEVGDAVDVRVETVKV
DVSSKSGVKRARTISLEQQPSVHVTYKHLTRDSKQKLESLLQQWSEWEAEQNSLSEDQEQ
VLEAGDETYFPALRVGLQKTSSVSFWFDYQTGHSSSKKSVPVESSTTPLYNRGFTIGLDS
GSNNVEGGLEIIDDPPRCFNCGAYSHSIRECPRPFDRSAVSNARRQHKRKRNQTPGSRLP
SRYYQSLQRGKYDGLKPGSLDAETRKLLGLKELDPPPWLNRMREIGYPPGYFAVEEDDDD
HSRITIFGEEETKEEEEVKTEEGEILEKASPQEPRKIMTVGFPGINAPIPENADSWLWEQ
RNSNTGHTNYHNHLRPQYEMGPLGIQLSSSFPPMHGIRYDHRFGL

METEDVLDIPASSNFGSEVKKNSLESGNGSPEANSLVGNDENVKGNLDLDLTEENLRIVG
GQESGEILTEQVSDVFNASVESVAVDEKLGIQKETLVHSTTLDVSSKAGVKRPRTSYDEQ
QPTVHVTYKHLTRASKQKLESLLQKWSEWEAENTSLAQDQEQLFESGEETCFPAIRVGLQ
KTSSVSFWIDNQTGHKPLEDFVLVESSTTPLYDRKFAIGLNSADGSRNVEGGLEIIDDDP
PRCFNCGGYSHSLRECPRPFDRSAVNSARKLQKSKRNQNSSGPRLPSRYYQKTQTGKYDG
LKPGTLDAETRQLLNLGELDPPPWLNRMREIGYPPGYLAPEDDHLSGITIFGEEVETREE
IESEDGEILEKANHPPEPQMKKTVEFPGINAPFPENADEWLWEAAPSHRNSSRSGRWQQQ
KTSRGHDYRDDGPLGVEPSSYPPRYGSRYDYGYGSNEYGSRSRSPGIDRSLSERSKRDYS
SYDADFRERDRDRDRNRDRDRDRDWDRDRDRDCDRDRDRDDRDWSYRLSSRR

www.000webhost.com

Other information
Ka divergence:-0.235555KaKs divergence:-0.122046
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1218Length 2 (bp):1599Length divergence:0.135
MFE 1 (kcal):-347.62MFE 2 (kcal):-462.22MFE divergence0.142